Diaphorina citri psyllid: psy11904


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MSHCAETWALNNGDRITSVRISFRHMVYEDALTILSYASPYEVQIETEKEIYFIMVCSKCEKKLGKVITPDNWKSGSRNTIESGGRRIGENKALTASKARFNPYTQKFESCKICRQKVHQVGSHYCQACAYKKGEHLVLVTADPEKGDKFALISGEHLVLVTADPEKGDKFAFDNHAFKEGTPIIRTLEDDKLKVSVPG
ccccccccccccccEEEEEEEEccccccHHHHHHHHccccCEEEEEEEEEcccHHHHcHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccEEEEEECccccccccccccccccccccEEEECccccCEEcccc
********ALNNGDRITSVRISFRHMVYEDALTILSYASPYEVQIETEKEIYFIMVCSKCEKKLGKVITPDNW*************************ARFNPYTQKFESCKICRQKVHQVGSHYCQACAYKKGEHLVLVTADPEKGDKFALISGEHLVLVTADPEKGDKFAFDNHAFKEGTPIIRTLEDDKLKVSVP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSHCAETWALNNGDRITSVRISFRHMVYEDALTILSYASPYEVQIETEKEIYFIMVCSKCEKKLGKVITPDNWKSGSRNTIESGGRRIGENKALTASKARFNPYTQKFESCKICRQKVHQVGSHYCQACAYKKGEHLVLVTADPEKGDKFALISGEHLVLVTADPEKGDKFAFDNHAFKEGTPIIRTLEDDKLKVSVPG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cysteine-rich PDZ-binding protein confidentQ5ZKB6
Cysteine-rich PDZ-binding protein Involved in the cytoskeletal anchoring of DLG4 in excitatory synapses.confidentQ3ZC66
Cysteine-rich PDZ-binding protein Involved in the cytoskeletal anchoring of DLG4 in excitatory synapses.confidentO70333

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0031122 [BP]cytoplasmic microtubule organizationprobableGO:0006996, GO:0007017, GO:0007010, GO:0071822, GO:0043933, GO:0009987, GO:0016043, GO:0008150, GO:0000226, GO:0071840, GO:0044763, GO:0044699
GO:0045184 [BP]establishment of protein localizationprobableGO:0033036, GO:0008104, GO:0008150, GO:0051179, GO:0051234
GO:0030165 [MF]PDZ domain bindingprobableGO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0043198 [CC]dendritic shaftprobableGO:0044463, GO:0044464, GO:0030425, GO:0005575, GO:0097458, GO:0005623, GO:0043005, GO:0042995
GO:0014069 [CC]postsynaptic densityprobableGO:0030425, GO:0043229, GO:0043228, GO:0044430, GO:0044327, GO:0043226, GO:0005856, GO:0044446, GO:0044309, GO:0097458, GO:0044456, GO:0043005, GO:0042995, GO:0043197, GO:0043232, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044422, GO:0045202
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0030054 [CC]cell junctionprobableGO:0005575
GO:0032403 [MF]protein complex bindingprobableGO:0003674, GO:0005488, GO:0005515

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KL1, chain A
Confidence level:probable
Coverage over the Query: 2-50,61-75
View the alignment between query and template
View the model in PyMOL
Template: 1M3V, chain A
Confidence level:probable
Coverage over the Query: 110-132
View the alignment between query and template
View the model in PyMOL