Diaphorina citri psyllid: psy11920

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880----

MAGRGGRGAALKQILEAKRREEEEKRPGSLPTTSTDDTTGSHAPGIPSPSTSSPSQASEPAPKHIGRGRLLQQLLAKGVVPTSGTPGPGGDAPSSPPTQQMKALSISKSKPPSEPVYFRGELGQPIKVMVNYIDLSVKEGSGMYEYEVKFNPPIDSRGIRNRLINSLNDLLGQYKTFDGMNLFLPFKLSSDTVNTTCQTREGSDVQITIIFKRQRQFYENLMFYNILFRKIAFLLSMVQFKDCLYDPRSKLLIPQYKLEVWPGFVTAIDEYEGGLKLQIDTSCRVLRTSTCLDLIDELKEKFGGNFMERLSQALIGEIVLTRYNNQTYRIDEIDFKQTPMSTFTKRGEPKSYVDYYREAYNIEIRDKSQPMLITRVKRKTRRGTNVEESHYIAAIVPELAFLTGLSDAMRNDFQVMKSIASFTRVDPNQKLQAISKYINNVNNNKETSELLKGWGLTLNKSMETLNARILPVEKIYMGNNFVAPGSQEADWNRQVGTNPALTVVNFDQWVLIHIRRDQRNADNFLNCLNRNSNAIGIRVKKPQVIALQEEQTLSYLTALKSMRSDTQFVVIIFNAPRTDRYQAVKKYCCCERPIPSQVINSRTISREDKMKSIVMKIALQINCKLGGSLWSVQIPYDCAMVIGIDVYHEGVGSQGQNIVGLVASTNKDFTTYYSQAVIQRRGQEITDSIAQPFKQALDRFIQANSVPPKQIFIFRDGVSDGQLDSVSRVEIDQYQQIVDTIMTTLPSCSYAPKITAIIVQKRINTKIFQLLSAGERPNLANAPSGSVLDHTVTRKTLSDFFLVSQHVRQGTVTPSHYIVLRNDNNVKVDHLQRLSYKLCHLYYNWPGTIRVPAVCQYAHRIAYLTGMHLQRLPSDVLSDKLFYL

cccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEECcccccEEEEEEEECcccccHHHHHHHHHHHHHHccccCECcccEEEEECccccccEEEEECcccccEEEEEEEEEEEccHHHHHHHHHHHHHHHHHccccEEccccccccccccccccccEEEEccEEEEEEcccccEEEEEEccccccccccHHHHHHHHHHHccHHHHHHHHHHccccEEEEEccccEEEEEECccccccccCECcccccEEHHHHHHHHcccccccccccEEEEcccccccccccccccccEEEEcccccccccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccHHHHHHHcccEEcccccEEEEEEccccEEcccccccccccccccccccccccccccccCEcEEEEEEEcccHHHHHHHHHHHHHHHHccccccccccEEEcccccHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHcccccccCEEEEcccccccccHHHHHHHHHHHHHHHccccccccccccccEEEEEEEccccccccccccEEEEEEEEccccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEEcccccccccccccccccccccccCEEcccccccccccEEEEEccccccccccccEEEEEccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccc

************************************************************************************************************************ELGQPIKVMVNYIDLSVKEGSGMYEYEVKFNPPIDSRGIRNRLINSLNDLLGQYKTFDGMNLFLPFKLSSDTVNTTCQTREGSDVQITIIFKRQRQFYENLMFYNILFRKIAFLLSMVQFKDCLYDPRSKLLIPQYKLEVWPGFVTAIDEYEGGLKLQIDTSCRVLRTSTCLDLIDELKEKFGGNFMERLSQALIGEIVLTRYNNQTYRIDEIDFKQTPMSTFTKRGEPKSYVDYYREAYNIEIRDKSQPMLITRVKR*******VEESHYIAAIVPELAFLTGLSDAMRNDFQVMKSIASFTRVDPNQKLQAISKYINNVNNNKETSELLKGWGLTLNKSMETLNARILPVEKIYMGNNFVAPGSQEADWNRQVGTNPALTVVNFDQWVLIHIRRDQRNADNFLNCLNRNSNAIGIRVKKPQVIALQEEQTLSYLTALKSMRSDTQFVVIIFNAPRTDRYQAVKKYCCCERPIPSQVINSRTISREDKMKSIVMKIALQINCKLGGSLWSVQIPYDCAMVIGIDVYHEGVGSQGQNIVGLVASTNKDFTTYYSQAVIQRRGQEITDSIAQPFKQALDRFIQANSVPPKQIFIFRDGVSDGQLDSVSRVEIDQYQQIVDTIMTTLPSCSYAPKITAIIVQKRINTKIFQLLSAGE*****NAPSGSVLDHTVTRKTLSDFFLVSQHVRQGTVTPSHYIVLRNDNNVKVDHLQRLSYKLCHLYYNWPGTIRVPAVCQYAHRIAYLTGMHLQRLPSDVLSDKLFYL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Piwi-like protein 1	Plays a central role during gametogenesis by repressing transposable elements and prevent their mobilization, which is essential for the germline integrity. Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons. Directly binds methylated piRNAs, a class of 24 to 30 nucleotide RNAs that are generated by a Dicer-independent mechanism and are primarily derived from transposons and other repeated sequence elements. Besides their function in transposable elements repression, piRNAs are probably involved in other processes during meiosis such as translation regulation.	confident	A6N7Y9
Piwi-like protein 1	Plays a central role during spermatogenesis by repressing transposable elements and prevent their mobilization, which is essential for the germline integrity. Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons. Directly binds methylated piRNAs, a class of 24 to 30 nucleotide RNAs that are generated by a Dicer-independent mechanism and are primarily derived from transposons and other repeated sequence elements. Besides their function in transposable elements repression, piRNAs are probably involved in other processes during meiosis such as translation regulation. Probable component of some RISC complex, which mediates RNA cleavage and translational silencing. Also plays a role in the formation of chromatoid bodies and is required for some miRNAs stability.	confident	Q9JMB7
Piwi-like protein 2	Plays a central role during gametogenesis by repressing transposable elements and prevent their mobilization, which is essential for the germline integrity. Plays an essential role in germ cell differentiation and meiosis, independently of the function in transposable elements repression. Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons. Directly binds piRNAs, a class of 24 to 30 nucleotide RNAs that are generated by a Dicer-independent mechanism and are primarily derived from transposons and other repeated sequence elements. The piRNA process acts upstream of known mediators of DNA methylation. Besides their function in transposable elements repression, piRNAs are probably involved in other processes such as translation regulation.	confident	A8KBF3

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0043186 [CC]	P granule	confident	GO:0005737, GO:0035770, GO:0043232, GO:0060293, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226, GO:0045495
GO:0034584 [MF]	piRNA binding	confident	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0005875 [CC]	microtubule associated complex	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0071011 [CC]	precatalytic spliceosome	probable	GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071013 [CC]	catalytic step 2 spliceosome	probable	GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0000791 [CC]	euchromatin	probable	GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0000785, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0033391 [CC]	chromatoid body	probable	GO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0010369 [CC]	chromocenter	probable	GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0071547 [CC]	piP-body	probable	GO:0005737, GO:0035770, GO:0043232, GO:0060293, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0043226, GO:0044424, GO:0043186, GO:0005622, GO:0032991, GO:0045495
GO:0031933 [CC]	telomeric heterochromatin	probable	GO:0000792, GO:0005575, GO:0043232, GO:0044464, GO:0044446, GO:0005623, GO:0005622, GO:0000781, GO:0043229, GO:0043228, GO:0000785, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0005700 [CC]	polytene chromosome	probable	GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0005845 [CC]	mRNA cap binding complex	probable	GO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0034518, GO:0044424
GO:0003727 [MF]	single-stranded RNA binding	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0003729 [MF]	mRNA binding	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0005844 [CC]	polysome	probable	GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0030529
GO:0007286 [BP]	spermatid development	probable	GO:0048610, GO:0022412, GO:0048468, GO:0019953, GO:0032501, GO:0007276, GO:0000003, GO:0048869, GO:0048515, GO:0030855, GO:0002064, GO:0032502, GO:0030154, GO:0048609, GO:0032504, GO:0060429, GO:0009888, GO:0044767, GO:0022414, GO:0007283, GO:0044763, GO:0048232, GO:0007281, GO:0044699, GO:0044702, GO:0003006, GO:0048856, GO:0008150, GO:0009987
GO:0035278 [BP]	negative regulation of translation involved in gene silencing by miRNA	probable	GO:0009892, GO:0080090, GO:0009890, GO:0051246, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0040029, GO:0010629, GO:0050789, GO:0044699, GO:0051248, GO:0010605, GO:0019222, GO:0010608, GO:2000112, GO:2000113, GO:0016458, GO:0065007, GO:0045974, GO:0010468, GO:0060255, GO:0009987, GO:0009889, GO:0050794, GO:0016441, GO:0044763, GO:0031047, GO:0048519, GO:0040033, GO:0032269, GO:0032268, GO:0035194, GO:0035195, GO:0010556, GO:0017148, GO:0006417, GO:0008150, GO:0010558, GO:0048523
GO:0000335 [BP]	negative regulation of transposition, DNA-mediated	probable	GO:0009892, GO:0080090, GO:0019222, GO:0031324, GO:0031323, GO:0065007, GO:0050789, GO:0051052, GO:0010605, GO:0019219, GO:0010528, GO:0010529, GO:0048519, GO:0045910, GO:0051053, GO:0045934, GO:0000337, GO:0060255, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:0000018, GO:0048523
GO:0030423 [BP]	targeting of mRNA for destruction involved in RNA interference	probable	GO:0022607, GO:0009892, GO:0019222, GO:0043933, GO:0010629, GO:0034622, GO:0050789, GO:0071840, GO:0071826, GO:0010605, GO:0010608, GO:0040029, GO:0016043, GO:0065003, GO:0016458, GO:0022618, GO:0065007, GO:0044699, GO:0022613, GO:0016246, GO:0010468, GO:0060255, GO:0009987, GO:0008150, GO:0031047, GO:0048519, GO:0035194, GO:0044085, GO:0016441, GO:0044763
GO:0070725 [CC]	Yb body	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0007126 [BP]	meiosis	probable	GO:0048610, GO:0051321, GO:0000003, GO:0009987, GO:0008150, GO:0022402, GO:0044699, GO:0044763, GO:0007049
GO:0048132 [BP]	female germ-line stem cell division	probable	GO:0048610, GO:0042078, GO:0030154, GO:0048468, GO:0019953, GO:0007292, GO:0008356, GO:0051301, GO:0000003, GO:0048869, GO:0007276, GO:0048477, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0007281, GO:0022414, GO:0044763, GO:0022412, GO:0044767, GO:0044699, GO:0044702, GO:0003006, GO:0048856, GO:0008150, GO:0017145
GO:0048133 [BP]	male germ-line stem cell division	probable	GO:0048610, GO:0042078, GO:0022412, GO:0048468, GO:0019953, GO:0008356, GO:0051301, GO:0000003, GO:0048869, GO:0007276, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0044767, GO:0022414, GO:0007283, GO:0044763, GO:0048232, GO:0007281, GO:0044699, GO:0044702, GO:0003006, GO:0048856, GO:0030154, GO:0008150, GO:0017145
GO:0001556 [BP]	oocyte maturation	probable	GO:0048610, GO:0009994, GO:0030154, GO:0048468, GO:0007569, GO:0007292, GO:0010259, GO:0007276, GO:0000003, GO:0048869, GO:0044699, GO:0048477, GO:0032502, GO:0048599, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0019953, GO:0007281, GO:0022414, GO:0044763, GO:0022412, GO:0044767, GO:0044702, GO:0003006, GO:0048856, GO:0008150
GO:0007279 [BP]	pole cell formation	probable	GO:0048610, GO:0030154, GO:0048468, GO:0019953, GO:0009653, GO:0007275, GO:0044699, GO:0007277, GO:0000003, GO:0048869, GO:0007349, GO:0007276, GO:0048646, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0044767, GO:0022414, GO:0008150, GO:0022412, GO:0044702, GO:0044707, GO:0003006, GO:0048856, GO:0044763
GO:0007318 [BP]	pole plasm protein localization	probable	GO:0008105, GO:0008104, GO:0009994, GO:0030154, GO:0048468, GO:0007569, GO:0007292, GO:0009790, GO:0008358, GO:0048610, GO:0000578, GO:0009798, GO:0007308, GO:0007309, GO:0035282, GO:0010259, GO:0007275, GO:0044699, GO:0048609, GO:0007389, GO:0022414, GO:0007276, GO:0000003, GO:0009948, GO:0007028, GO:0016043, GO:0071840, GO:0033036, GO:0048477, GO:0032502, GO:0048599, GO:0032501, GO:0022607, GO:0009880, GO:0032504, GO:0009987, GO:0019953, GO:0007281, GO:0008595, GO:0007315, GO:0007314, GO:0044763, GO:0003002, GO:0022412, GO:0007351, GO:0007350, GO:0051179, GO:0044767, GO:0044702, GO:0009952, GO:0044707, GO:0003006, GO:0048856, GO:0044085, GO:0048869, GO:0008150
GO:0035197 [MF]	siRNA binding	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0000932 [CC]	cytoplasmic mRNA processing body	probable	GO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0071546 [CC]	pi-body	probable	GO:0005737, GO:0035770, GO:0043232, GO:0060293, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0043226, GO:0044424, GO:0043186, GO:0005622, GO:0032991, GO:0045495
GO:0045840 [BP]	positive regulation of mitosis	probable	GO:0051130, GO:0090068, GO:0007346, GO:0045787, GO:0051726, GO:0010638, GO:0033043, GO:0010564, GO:0050794, GO:0051783, GO:0065007, GO:0008150, GO:0051785, GO:0048518, GO:0051128, GO:0007088, GO:0050789, GO:0048522
GO:0007317 [BP]	regulation of pole plasm oskar mRNA localization	probable	GO:2000241, GO:0051239, GO:0060341, GO:0050793, GO:0060281, GO:0060284, GO:0050794, GO:0008150, GO:0044087, GO:0045595, GO:2000026, GO:0045995, GO:0065007, GO:0032879, GO:0051128, GO:0050789
GO:0000966 [BP]	RNA 5'-end processing	probable	GO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0006396, GO:0046483
GO:0030718 [BP]	germ-line stem cell maintenance	probable	GO:0030154, GO:0048468, GO:0050789, GO:0044699, GO:0048863, GO:0048864, GO:0048869, GO:0065007, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0044767, GO:0045596, GO:0045595, GO:0008150, GO:0051093, GO:0019827, GO:0044707, GO:0048856, GO:0044763, GO:0048523
GO:0030717 [BP]	karyosome formation	probable	GO:0006996, GO:0044702, GO:0048610, GO:0051276, GO:0032504, GO:0071840, GO:0009987, GO:0019953, GO:0016043, GO:0007292, GO:0022414, GO:0032501, GO:0044763, GO:0044699, GO:0048609, GO:0022412, GO:0008150, GO:0048477, GO:0007276, GO:0000003
GO:0046594 [BP]	maintenance of pole plasm mRNA location	probable	GO:0022607, GO:0009994, GO:0007351, GO:0048468, GO:0007569, GO:0044702, GO:0009790, GO:0008358, GO:0048610, GO:0016043, GO:0000578, GO:0007309, GO:0007308, GO:0009798, GO:0035282, GO:0010259, GO:0007275, GO:0044699, GO:0048609, GO:0007389, GO:0022414, GO:0007276, GO:0000003, GO:0003006, GO:0070727, GO:0009948, GO:0007028, GO:0006403, GO:0060811, GO:0060810, GO:0044085, GO:0065007, GO:0071840, GO:0033036, GO:0048477, GO:0032502, GO:0048599, GO:0032501, GO:0007292, GO:0009880, GO:0032504, GO:0019094, GO:0019953, GO:0007281, GO:0007316, GO:0007315, GO:0007314, GO:0008150, GO:0003002, GO:0022412, GO:0051237, GO:0051235, GO:0007350, GO:0051179, GO:0051641, GO:0044767, GO:0065008, GO:0009952, GO:0044707, GO:0008595, GO:0048856, GO:0008298, GO:0048869, GO:0030154, GO:0044763, GO:0009987
GO:0034585 [BP]	21U-RNA metabolic process	probable	GO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:0034660, GO:1901360, GO:0046483
GO:0034587 [BP]	piRNA metabolic process	probable	GO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:0034660, GO:1901360, GO:0046483
GO:0034583 [MF]	21U-RNA binding	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0007076 [BP]	mitotic chromosome condensation	probable	GO:0071103, GO:0090304, GO:0034641, GO:0006807, GO:0022402, GO:0016043, GO:0007067, GO:0044699, GO:0006139, GO:0044260, GO:1901360, GO:0000280, GO:0006323, GO:0071704, GO:0071840, GO:0000278, GO:0044238, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0007059, GO:0046483, GO:0006996, GO:0030261, GO:0007049, GO:0000070, GO:0000819, GO:0051276, GO:0044237, GO:0043170, GO:0048285, GO:0006259, GO:0044763
GO:0003677 [MF]	DNA binding	probable	GO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0043046 [BP]	DNA methylation involved in gamete generation	probable	GO:0048610, GO:0019222, GO:0019953, GO:0090304, GO:0034641, GO:0006807, GO:0050789, GO:0044699, GO:0006306, GO:0006305, GO:0006304, GO:0000003, GO:0044260, GO:1901360, GO:0040029, GO:0071704, GO:0065007, GO:0007276, GO:0032259, GO:0010468, GO:0032501, GO:0048609, GO:0032504, GO:0006139, GO:0060255, GO:0009987, GO:0006725, GO:0022414, GO:0043412, GO:0044728, GO:0043414, GO:0008152, GO:0046483, GO:0044238, GO:0044702, GO:0044237, GO:0043170, GO:0006259, GO:0008150
GO:0001709 [BP]	cell fate determination	probable	GO:0032502, GO:0045165, GO:0048869, GO:0030154, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0060213 [BP]	positive regulation of nuclear-transcribed mRNA poly(A) tail shortening	probable	GO:0009896, GO:0009894, GO:0009893, GO:0031329, GO:0050685, GO:0050684, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0060255, GO:0065007, GO:1900151, GO:0048518, GO:0010468, GO:0045935, GO:0019219, GO:0031331, GO:0061013, GO:0061014, GO:0050794, GO:0060211, GO:0008150, GO:0051171, GO:0051173, GO:0019222, GO:0031442, GO:0031440, GO:0051252, GO:0051254, GO:0048522
GO:0035068 [CC]	micro-ribonucleoprotein complex	probable	GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0030529
GO:0046843 [BP]	dorsal appendage formation	probable	GO:0048610, GO:0030154, GO:0048468, GO:0019953, GO:0010927, GO:0007292, GO:0007304, GO:0007306, GO:0009653, GO:0044699, GO:0007276, GO:0000003, GO:0030703, GO:0030707, GO:0016043, GO:0032989, GO:0071840, GO:0048477, GO:0048646, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0044767, GO:0022414, GO:0008150, GO:0022412, GO:0044702, GO:0003006, GO:0048856, GO:0048869, GO:0044763
GO:0070868 [BP]	heterochromatin organization involved in chromatin silencing	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0040029, GO:0010629, GO:0050789, GO:0044699, GO:0010605, GO:0019222, GO:0006325, GO:0006342, GO:0070828, GO:2000112, GO:2000113, GO:0016043, GO:0008150, GO:0019219, GO:0016458, GO:0065007, GO:0071840, GO:0048519, GO:0045814, GO:0010468, GO:0045934, GO:0060255, GO:0009987, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0006996, GO:0051276, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0044763, GO:0010558, GO:0048523
GO:0046011 [BP]	regulation of oskar mRNA translation	probable	GO:0032268, GO:0009889, GO:0080090, GO:0019222, GO:0051246, GO:0060255, GO:0010608, GO:0031323, GO:2000112, GO:0050794, GO:0050789, GO:0010556, GO:0065007, GO:0031326, GO:0006417, GO:0008150, GO:0010468
GO:0006402 [BP]	mRNA catabolic process	probable	GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006401, GO:0044238, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0016071, GO:0044270, GO:0044237, GO:0043170, GO:0019439

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F3T, chain A
Confidence level:very confident
Coverage over the Query: 112-884
View the alignment between query and template
View the model in PyMOL

Template: 1U04, chain A
Confidence level:very confident
Coverage over the Query: 139-148,162-189,200-478,490-528,542-884
View the alignment between query and template
View the model in PyMOL