Diaphorina citri psyllid: psy11928


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
MYAHCDLQPQQGELKKNHRLRIGRFDQHSGEHLTAEETPAEYLQRLFNLPYEKARKQLGTFGLAGHAHTIKMKDLSGGQKARVALAELTLNAPDVIILDEPTNNLDIESIDALADAINEYKGGVIIVSHDERLIRDTECTLWVIENQTIEEIDGDFDDYRKELLEALGEVVNNPSIVANMAVEQ
cccccccccccCEEEEccccEEEEEcccccccccccccHHHHHHHHccccHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHcccccEEEEEccHHHHHHHccEEEEEEccEEEEEcccHHHHHHHHHHHHHHHHccccHHHHHHHcc
MYAHCDLQPQQGELKKNHRLRIGRFDQHSGEHLTAEETPAEYLQRLFNLPYEKARKQLGTFGLAGHAHTIKMKDLSGGQKARVALAELTLNAPDVIILDEPTNNLDIESIDALADAINEYKGGVIIVSHDERLIRDTECTLWVIENQTIEEIDGDFDDYRKELLEALGEVVNNP**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYAHCDLQPQQGELKKNHRLRIGRFDQHSGEHLTAEETPAEYLQRLFNLPYEKARKQLGTFGLAGHAHTIKMKDLSGGQKARVALAELTLNAPDVIILDEPTNNLDIESIDALADAINEYKGGVIIVSHDERLIRDTECTLWVIENQTIEEIDGDFDDYRKELLEALGEVVNNPSIVANMAVEQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP-binding cassette sub-family F member 1 Required for efficient Cap- and IRES-mediated mRNA translation initiation. Not involved in the ribosome biogenesis.confidentQ6P542
ATP-binding cassette sub-family F member 1 Isoform 2 is required for efficient Cap- and IRES-mediated mRNA translation initiation. Isoform 2 is not involved in the ribosome biogenesis.confidentQ8NE71
ATP-binding cassette sub-family F member 1 Required for efficient Cap- and IRES-mediated mRNA translation initiation. Not involved in the ribosome biogenesis.confidentQ767L0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044425 [CC]membrane partprobableGO:0005575, GO:0016020
GO:0042254 [BP]ribosome biogenesisprobableGO:0022613, GO:0044085, GO:0008150, GO:0071840
GO:0043022 [MF]ribosome bindingprobableGO:0043021, GO:0003674, GO:0005488
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0006412 [BP]translationprobableGO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:1901576
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0008494 [MF]translation activator activityprobableGO:0090079, GO:0045182, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363
GO:0016887 [MF]ATPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0042788 [CC]polysomal ribosomeprobableGO:0005737, GO:0005844, GO:0032991, GO:0005840, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0005622, GO:0043226
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0045727 [BP]positive regulation of translationprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010608, GO:0009891, GO:2000112, GO:0051247, GO:0051246, GO:0032270, GO:0048518, GO:0065007, GO:0010468, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0032268, GO:0010557, GO:0010556, GO:0006417, GO:0048522
GO:0046581 [CC]intercellular canaliculusprobableGO:0005575, GO:0030054, GO:0005911
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IW3, chain A
Confidence level:very confident
Coverage over the Query: 21-161
View the alignment between query and template
View the model in PyMOL
Template: 3GFO, chain A
Confidence level:very confident
Coverage over the Query: 2-159
View the alignment between query and template
View the model in PyMOL