Diaphorina citri psyllid: psy1192

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
IHLENIQIIFLSHNFPGKLLHKDLDDRALDALKEYPSEGAIAVLNQFLESNLEHVSNKSAFLCGIMKTYRQKSRSGMAGVASTSAVLTLKGPDEEKIKFGSGSDFGLL
ccHHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHccccccccccc
***ENIQIIFLSHNFPGKLLHKDLDDRALDALKEYPSEGAIAVLNQFLESNLEHVSNKSAFLCGIMKTYR**************************IKFGSGSDFGLL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
IHLENIQIIFLSHNFPGKLLHKDLDDRALDALKEYPSEGAIAVLNQFLESNLEHVSNKSAFLCGIMKTYRQKSRSGMAGVASTSAVLTLKGPDEEKIKFGSGSDFGLL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0035770 [CC]ribonucleoprotein granuleprobableGO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0030529, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005622, GO:0043226
GO:0070937 [CC]CRD-mediated mRNA stability complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0010608 [BP]posttranscriptional regulation of gene expressionprobableGO:0019222, GO:0060255, GO:0050789, GO:0008150, GO:0065007, GO:0010468
GO:0071204 [CC]histone pre-mRNA 3'end processing complexprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0008143 [MF]poly(A) RNA bindingprobableGO:0005488, GO:0097159, GO:0070717, GO:0003727, GO:0003674, GO:0003723, GO:0003676, GO:1901363, GO:0003729
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0071011 [CC]precatalytic spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071346 [BP]cellular response to interferon-gammaprobableGO:0002376, GO:0051716, GO:0034097, GO:0071345, GO:0050896, GO:0045087, GO:0009987, GO:0006950, GO:0034341, GO:0006952, GO:0071310, GO:0044763, GO:0008150, GO:0070887, GO:0006955, GO:0042221, GO:0010033, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted