Diaphorina citri psyllid: psy11930


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270----
MEYQGSKDFFMPNKREDSYSTLSWRKAIKSTLWKNGGWMNIPQGRPANCPPGLEYLTTVDQLMVKQKVELLEALIGWETNNKFTVKNAQGQKVFLAVEINDCCTRNCCGPLRPFEMKVLDNYKNEVIHFERPLACDSCWFPCCLQSLNVFSPPGALIGSIEQEWSLLTPIFVIKNGAGDIVLRIEGPICRYSMCGGDVDFKILSRDGQTEVGRISKQWSGLLREAFTDADYFGISFPGDLDVRMKAVMLGACFLIDAMFYEKAGNRESDGIGML
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcHHHHHHHccccccCEEEEcccccEEEEEEEEcccCCcccccccccEEEEEEEccccEEEEEEcccccccccccccccccEEEcccccEEEEEEcccccccccEEEEcccccCEEEEEcccEEEcccccccccEEEcccccEEEEEEEEcccccccccccccccCEEEccccccHHHHHHHHHHHHHHHHHHHcccccccccccccc
*******************STLSWRKAIKSTLWKNGGWMNIPQGRPANCPPGLEYLTTVDQLMVKQKVELLEALIGWETNNKFTVKNAQGQKVFLAVEINDCCTRNCCGPLRPFEMKVLDNYKNEVIHFERPLACDSCWFPCCLQSLNVFSPPGALIGSIEQEWSLLTPIFVIKNGAGDIVLRIEGPICRYSMCGGDVDFKILSRDGQTEVGRISKQWSGLLREAFTDADYFGISFPGDLDVRMKAVMLGACFLIDAMFYE*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEYQGSKDFFMPNKREDSYSTLSWRKAIKSTLWKNGGWMNIPQGRPANCPPGLEYLTTVDQLMVKQKVELLEALIGWETNNKFTVKNAQGQKVFLAVEINDCCTRNCCGPLRPFEMKVLDNYKNEVIHFERPLACDSCWFPCCLQSLNVFSPPGALIGSIEQEWSLLTPIFVIKNGAGDIVLRIEGPICRYSMCGGDVDFKILSRDGQTEVGRISKQWSGLLREAFTDADYFGISFPGDLDVRMKAVMLGACFLIDAMFYEKAGNRESDGIGML

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phospholipid scramblase 1 May play a role in the antiviral response of interferon (IFN) by amplifying and enhancing the IFN response through increased expression of select subset of potent antiviral genes. May contribute to cytokine-regulated cell proliferation and differentiation.confidentQ9JJ00
Phospholipid scramblase 1 May play a role in the antiviral response of interferon (IFN) by amplifying and enhancing the IFN response through increased expression of select subset of potent antiviral genes. May contribute to cytokine-regulated cell proliferation and differentiation.confidentP58195
Phospholipid scramblase 1 May play a role in the antiviral response of interferon (IFN) by amplifying and enhancing the IFN response through increased expression of select subset of potent antiviral genes. May contribute to cytokine-regulated cell proliferation and differentiation.confidentO15162

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044763 [BP]single-organism cellular processconfidentGO:0009987, GO:0008150, GO:0044699
GO:0001077 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcriptionprobableGO:0003700, GO:0001228, GO:0003674, GO:0001071, GO:0000982, GO:0000981
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0032091 [BP]negative regulation of protein bindingprobableGO:0051098, GO:0051100, GO:0008150, GO:0065007, GO:0044092, GO:0043393, GO:0065009
GO:2000373 [BP]positive regulation of DNA topoisomerase (ATP-hydrolyzing) activityprobableGO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0051101, GO:0043388, GO:0050789, GO:0043085, GO:0043462, GO:0031329, GO:0051345, GO:0031323, GO:0030811, GO:0008150, GO:0065007, GO:0044093, GO:0065009, GO:0033121, GO:0050790, GO:0019219, GO:0032781, GO:2000371, GO:0050794, GO:0051174, GO:0010911, GO:0051171, GO:0010912, GO:0009118, GO:0051336, GO:1900542, GO:0051099, GO:0051098, GO:0006140
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0017121 [BP]phospholipid scramblingprobableGO:0016044, GO:0071840, GO:0009987, GO:0097035, GO:0008150, GO:0061024, GO:0007009, GO:0044763, GO:0016043, GO:0065007, GO:0065008, GO:0044699
GO:0031012 [CC]extracellular matrixprobableGO:0005575
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0007268 [BP]synaptic transmissionprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0044699, GO:0003008
GO:0017124 [MF]SH3 domain bindingprobableGO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0017128 [MF]phospholipid scramblase activityprobableGO:0005548, GO:0005319, GO:0022892, GO:0003674, GO:0005215
GO:0006659 [BP]phosphatidylserine biosynthetic processprobableGO:0044238, GO:0006650, GO:0042398, GO:0006658, GO:0019752, GO:0044249, GO:0006807, GO:0044281, GO:0044283, GO:0044255, GO:0045017, GO:0044710, GO:0044711, GO:0006520, GO:0071704, GO:0006082, GO:0008610, GO:0006644, GO:0006629, GO:1901576, GO:0009987, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0046486, GO:0090407, GO:0052646, GO:0008652, GO:1901564, GO:0006575, GO:1901566, GO:0008654, GO:1901137, GO:1901135, GO:0016053, GO:0044237, GO:0046394, GO:0006796, GO:0006793, GO:0019637, GO:0046474
GO:0097193 [BP]intrinsic apoptotic signaling pathwayprobableGO:0010259, GO:0044700, GO:0051716, GO:0009987, GO:0050896, GO:0006915, GO:0097190, GO:0050794, GO:0008150, GO:0012501, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0007569, GO:0050789, GO:0044699
GO:0035456 [BP]response to interferon-betaprobableGO:0042221, GO:0050896, GO:0008150, GO:0034097, GO:0010033
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0010225 [BP]response to UV-CprobableGO:0009628, GO:0009314, GO:0050896, GO:0009411, GO:0008150, GO:0009416
GO:0045121 [CC]membrane raftprobableGO:0005575, GO:0044425, GO:0016020
GO:0060368 [BP]regulation of Fc receptor mediated stimulatory signaling pathwayprobableGO:0009966, GO:0048583, GO:0050794, GO:0008150, GO:0002682, GO:0023051, GO:0065007, GO:0010646, GO:0050789
GO:0042609 [MF]CD4 receptor bindingprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0005154 [MF]epidermal growth factor receptor bindingprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515, GO:0070851
GO:0033003 [BP]regulation of mast cell activationprobableGO:0050865, GO:0050794, GO:0008150, GO:0002694, GO:0065007, GO:0002682, GO:0050789
GO:0015914 [BP]phospholipid transportprobableGO:0006810, GO:0051234, GO:0006869, GO:0006811, GO:0015748, GO:0015711, GO:0044765, GO:0006820, GO:0008150, GO:0071702, GO:0033036, GO:0010876, GO:0051179, GO:0044699
GO:0051607 [BP]defense response to virusprobableGO:0002376, GO:0009607, GO:0009615, GO:0050896, GO:0006952, GO:0006950, GO:0008150, GO:0002252, GO:0051707, GO:0051704
GO:0019899 [MF]enzyme bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0045071 [BP]negative regulation of viral genome replicationprobableGO:2000242, GO:0050792, GO:0045069, GO:2000241, GO:0050794, GO:0008150, GO:0043900, GO:0043901, GO:0065007, GO:0048525, GO:0048519, GO:0050789, GO:0048523
GO:0005509 [MF]calcium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0006955 [BP]immune responseprobableGO:0002376, GO:0050896, GO:0008150
GO:0030099 [BP]myeloid cell differentiationprobableGO:0032502, GO:0002376, GO:0009987, GO:0044707, GO:0048856, GO:0048869, GO:0032501, GO:0030154, GO:0044767, GO:0048513, GO:0044763, GO:0008150, GO:0048731, GO:0030097, GO:0048534, GO:0007275, GO:0044699, GO:0002520
GO:0071222 [BP]cellular response to lipopolysaccharideprobableGO:0070887, GO:0032496, GO:0044699, GO:0051716, GO:0033993, GO:0009617, GO:0071310, GO:0071219, GO:0071216, GO:0009987, GO:0071396, GO:0008150, GO:0042221, GO:0051707, GO:0010033, GO:0051704, GO:1901700, GO:1901701, GO:0009607, GO:0050896, GO:0002237, GO:0044763
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0035455 [BP]response to interferon-alphaprobableGO:0042221, GO:0050896, GO:0008150, GO:0034097, GO:0010033
GO:0043065 [BP]positive regulation of apoptotic processprobableGO:0050794, GO:0050789, GO:0048518, GO:0043067, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0045089 [BP]positive regulation of innate immune responseprobableGO:0050776, GO:0045088, GO:0080134, GO:0048584, GO:0048583, GO:0050778, GO:0031349, GO:0002684, GO:0002682, GO:0008150, GO:0048518, GO:0065007, GO:0050789, GO:0031347

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZXU, chain A
Confidence level:confident
Coverage over the Query: 52-67,80-131,145-217,228-260
View the alignment between query and template
View the model in PyMOL