Diaphorina citri psyllid: psy11933

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------8
MARGQQKLQSQAKAQEKQAKAKKQQGHSLLDQKKAAQKALVHACVVCKAQMPDPKTYKQHFENKHPKNDLPEDLKDVQA
ccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcHHHHcccccccHHHHHHHccccccccccHHHHHcc
************************************QKALVHACVVCKAQM***********************K****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARGxxxxxxxxxxxxxxxxxxxxxGHSLLDQKKAAQKALVHACVVCKAQMPDPKTYKQHFENKHPKNDLPEDLKDVQA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger protein 706 very confidentQ9Y5V0
Zinc finger protein 706 very confidentQ5ZMM5
Zinc finger protein 706 very confidentQ9D115

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0040010 [BP]positive regulation of growth rateprobableGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0005622 [CC]intracellularprobableGO:0005575, GO:0044464, GO:0005623
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WVK, chain A
Confidence level:confident
Coverage over the Query: 2-77
View the alignment between query and template
View the model in PyMOL