Diaphorina citri psyllid: psy11937

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300--
MSWSQPIAVESPGKSGAKFYQSYDRLFIIKTLTSEEVERMHSFLKQYHPYIVERHGKTLLPQYLGMYRLTVDGVEHYVVAMRNVFSNHLTTHKKFDLKGSTVDREASEKEKEKDLPTFKDNDFVQGGTKIVIGDEAKEKLLETLNADVEFLTNLHLMDYSLLVGIHDCARAEAEELANENNGGGGGADDEDEEDSEGVGDRIPWGTTPPDSPHTLNRETSLQYDGAIIPELDIYAIPSAENAPVKEIYFIALIDVLTHYGVKKQAAKAAKTLKHGANVDGISTCDPEQYGKRFIEFLSKAME
ccccccccccccccccccEEEEccccEEEEEccHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEEEccEEEEEEEEEcccccccccEEEEECcccccccccccccccccccccccccccccccCEEEcHHHHHHHHHHHHHHHHHHHcccccccccccEEEcHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEHHHHccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHcc
*****************KFYQSYDRLFIIKTLTSEEVERMHSFLKQYHPYIVERHGKTLLPQYLGMYRLTVDGVEHYVVAMRNVFSNHLTTHKKFDLKGSTVDRE*********LPTFKDNDFVQGGTKIVIGDEAKEKLLETLNADVEFLTNLHLMDYSLLVGIHDCAR**************************************************LQYDGAIIPELDIYAIPSAENAPVKEIYFIALIDVLTHYGVKKQAAKAAKTLKHGANVDGISTCDPEQYGKRFIEFLSKAME
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSWSQPIAVESPGKSGAKFYQSYDRLFIIKTLTSEEVERMHSFLKQYHPYIVERHGKTLLPQYLGMYRLTVDGVEHYVVAMRNVFSNHLTTHKKFDLKGSTVDREASEKEKEKDLPTFKDNDFVQGGTKIVIGDEAKEKLLETLNADVEFLTNLHLMDYSLLVGIHDCARAEAEELANENNGGGGGADDEDEEDSEGVGDRIPWGTTPPDSPHTLNRETSLQYDGAIIPELDIYAIPSAENAPVKEIYFIALIDVLTHYGVKKQAAKAAKTLKHGANVDGISTCDPEQYGKRFIEFLSKAME

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phosphatidylinositol 5-phosphate 4-kinase type-2 beta Participates in the biosynthesis of phosphatidylinositol 4,5-bisphosphate.confidentQ80XI4
Phosphatidylinositol 5-phosphate 4-kinase type-2 beta Participates in the biosynthesis of phosphatidylinositol 4,5-bisphosphate.confidentP78356
Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha Catalyzes the phosphorylation of phosphatidylinositol 5-phosphate (PtdIns5P) on the fourth hydroxyl of the myo-inositol ring, to form phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2). May exert its function by regulating the levels of PtdIns5P, which functions in the cytosol by increasing AKT activity and in the nucleus signals through ING2. May regulate the pool of cytosolic PtdIns5P in response to the activation of tyrosine phosphorylation. May negatively regulate insulin-stimulated glucose uptake by lowering the levels of PtdIns5P. May be involved in thrombopoiesis and the terminal maturation of megakaryocytes and regulation of their size.confidentO13010

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048468 [BP]cell developmentprobableGO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0044767, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0008360 [BP]regulation of cell shapeprobableGO:0022604, GO:0022603, GO:0050793, GO:0051128, GO:0065007, GO:0008150, GO:0065008, GO:0050789, GO:0050794
GO:0046854 [BP]phosphatidylinositol phosphorylationprobableGO:0044238, GO:0006644, GO:0006650, GO:0071704, GO:0016310, GO:0009987, GO:0044710, GO:0044237, GO:0046834, GO:0006796, GO:0046488, GO:0008152, GO:0006793, GO:0019637, GO:0008150, GO:0046486, GO:0030258, GO:0044255, GO:0006629
GO:0016324 [CC]apical plasma membraneprobableGO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0008289 [MF]lipid bindingprobableGO:0003674, GO:0005488
GO:0005768 [CC]endosomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0090406 [CC]pollen tubeprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0031090 [CC]organelle membraneprobableGO:0005575, GO:0016020, GO:0043227, GO:0043226, GO:0044422
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0048731 [BP]system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0016308 [MF]1-phosphatidylinositol-4-phosphate 5-kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0016307, GO:0003824, GO:0016740, GO:0003674
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0043167 [MF]ion bindingprobableGO:0003674, GO:0005488
GO:0008654 [BP]phospholipid biosynthetic processprobableGO:0071704, GO:1901576, GO:0006644, GO:0006629, GO:0044238, GO:0009987, GO:0006796, GO:0044237, GO:0044249, GO:0009058, GO:0044710, GO:0008150, GO:0008152, GO:0006793, GO:0019637, GO:0044255, GO:0090407, GO:0008610
GO:0007155 [BP]cell adhesionprobableGO:0008150, GO:0009987, GO:0022610, GO:0044763, GO:0044699
GO:0007015 [BP]actin filament organizationprobableGO:0006996, GO:0007010, GO:0071822, GO:0030029, GO:0043933, GO:0071840, GO:0009987, GO:0030036, GO:0044763, GO:0016043, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.1.-Phosphotransferases with an alcohol group as acceptor.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GK9, chain A
Confidence level:very confident
Coverage over the Query: 1-99,117-168
View the alignment between query and template
View the model in PyMOL