Diaphorina citri psyllid: psy11988


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------
NGFVECNRKSCPNQEGCHKLLEAKEKDGCCRKCQGCVHHGVFRESGSEWTDPDNPCRIFTCKAGVVTETEMQCYAPCKHPTPPGPGQCCPTCPGKRPYGLLYVAFGLLNATFGPPHVASGLLNVAFALLHVAFGFLVLSFGFQAFLTLKLGRFVSY
cccEEEEcccccccccccccccccccccccccccccEEccEEEccccECccccccccEEEEcccEEEEEECccccccccccccccccccccccccccccEEEccccEECccccccCEEEccccEEEEEEEcccccccccHHHHHHHHHcccccccc
*GFVECNRKSCPNQEGCHKLLEAKEKDGCCRKCQGCVHHGVFRESGSEWTDPDNPCRIFTCKAGVVTETEMQCYAPCKHPTPPGPGQCCPTCPGKRPYGLLYVAFGLLNATFGPPHVASGLLNVAFALLHVAFGFLVLSFGFQAFLTLKLGRFVS*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NGFVECNRKSCPNQEGCHKLLEAKEKDGCCRKCQGCVHHGVFRESGSEWTDPDNPCRIFTCKAGVVTETEMQCYAPCKHPTPPGPGQCCPTCPGKRPYGLLYVAFGLLNATFGPPHVASGLLNVAFALLHVAFGFLVLSFGFQAFLTLKLGRFVSY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0090092 [BP]regulation of transmembrane receptor protein serine/threonine kinase signaling pathwayprobableGO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1U5M, chain A
Confidence level:confident
Coverage over the Query: 35-94
View the alignment between query and template
View the model in PyMOL
Template: 1U5M, chain A
Confidence level:confident
Coverage over the Query: 1-35
View the alignment between query and template
View the model in PyMOL
Template: 3EJH, chain A
Confidence level:probable
Coverage over the Query: 35-80,97-122
View the alignment between query and template
View the model in PyMOL