Diaphorina citri psyllid: psy11996

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNNPNLYTQYQTQGKSCTGRYQVRPITSPHGAYHGDLRYHWTNRAPLKYVKRGTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNVIPYHYHMSQPYGNPYQFTHLAT
ccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccHHHHHHcccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccCECccccccccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccHHHHccccHHHHHHHccccccccccccccccccccccccccccc
****************YTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNNPNLYTQYQTQGKSCTGRYQVRPITSPHGAYHGDLRYHWTNRAPLKYVKRGTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHK****************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNNPNLYTQYQTQGKSCTGRYQVRPITSPHGAYHGDLRYHWTNRAPLKYVKRGTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNVIPYHYHMSQPYGNPYQFTHLAT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Homeotic protein Sex combs reduced Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Controls the segmental transformation of the first to the second thoracic segment (prothorax to mesothorax) and of the labial palps into maxillary palps. In embryo, required for fusion of labial lobes and development of the T1 denticle belt. In adult, expression in the head is necessary for proper development of the labium. In the first thoracic segment of the adult, required for proper development of the sex comb and to suppress improper prothoracic wing development.confidentP09077
Homeobox protein H55 (Fragment) Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.confidentP15859

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0002686 [BP]negative regulation of leukocyte migrationprobableGO:0030336, GO:0040013, GO:0030334, GO:2000145, GO:0065007, GO:0051271, GO:0051270, GO:0008150, GO:0040012, GO:0002685, GO:0002682, GO:0002683, GO:2000146, GO:0048519, GO:0032879, GO:0050794, GO:0050789, GO:0048523
GO:0048704 [BP]embryonic skeletal system morphogenesisprobableGO:0048705, GO:0048598, GO:0009887, GO:0048562, GO:0044707, GO:0048513, GO:0009790, GO:0048568, GO:0032501, GO:0048856, GO:0044767, GO:0001501, GO:0048706, GO:0008150, GO:0009792, GO:0048731, GO:0043009, GO:0009653, GO:0032502, GO:0007275, GO:0044699
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0009952 [BP]anterior/posterior pattern specificationprobableGO:0032502, GO:0007389, GO:0032501, GO:0044707, GO:0008150, GO:0003002, GO:0007275, GO:0044699
GO:0008134 [MF]transcription factor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0045617 [BP]negative regulation of keratinocyte differentiationprobableGO:0051093, GO:0051239, GO:0050793, GO:0048519, GO:0050794, GO:0008150, GO:0045596, GO:0045595, GO:0065007, GO:0030856, GO:0030857, GO:0045605, GO:0045604, GO:0045683, GO:0045682, GO:0045616, GO:0050789, GO:0048523, GO:2000026
GO:0001525 [BP]angiogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0001568, GO:0048856, GO:0001944, GO:0044767, GO:0072359, GO:0072358, GO:0048514, GO:0048646, GO:0048731, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0045656 [BP]negative regulation of monocyte differentiationprobableGO:0002761, GO:0051093, GO:0002762, GO:0045596, GO:0050793, GO:0050789, GO:0045655, GO:0050794, GO:1902105, GO:1902106, GO:0045638, GO:0065007, GO:0002682, GO:0008150, GO:0051239, GO:0048519, GO:2000026, GO:0045595, GO:0045637, GO:0048523
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0001953 [BP]negative regulation of cell-matrix adhesionprobableGO:0010810, GO:0030155, GO:0001952, GO:0050794, GO:0050789, GO:0007162, GO:0065007, GO:0008150, GO:0048519, GO:0010812, GO:0048523
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0048103 [BP]somatic stem cell divisionprobableGO:0009987, GO:0008150, GO:0051301, GO:0044763, GO:0017145, GO:0044699
GO:0060218 [BP]hematopoietic stem cell differentiationprobableGO:0032502, GO:0002376, GO:0048863, GO:0044707, GO:0048856, GO:0009987, GO:0048869, GO:0032501, GO:0030154, GO:0044767, GO:0048513, GO:0044763, GO:0008150, GO:0048731, GO:0030097, GO:0048534, GO:0007275, GO:0044699, GO:0002520
GO:0048468 [BP]cell developmentprobableGO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0044767, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0007494 [BP]midgut developmentprobableGO:0032502, GO:0055123, GO:0032501, GO:0048565, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0050905 [BP]neuromuscular processprobableGO:0032501, GO:0044707, GO:0050877, GO:0008150, GO:0044699, GO:0003008
GO:0045446 [BP]endothelial cell differentiationprobableGO:0032502, GO:0060429, GO:0003158, GO:0030154, GO:0009888, GO:0008150, GO:0044763, GO:0048869, GO:0030855, GO:0009987, GO:0044699, GO:0048856
GO:0050795 [BP]regulation of behaviorprobableGO:0008150, GO:0065007, GO:0048583, GO:0050789
GO:0007548 [BP]sex differentiationprobableGO:0032502, GO:0003006, GO:0008150, GO:0000003, GO:0022414
GO:0050890 [BP]cognitionprobableGO:0032501, GO:0044707, GO:0050877, GO:0008150, GO:0044699, GO:0003008
GO:0048609 [BP]multicellular organismal reproductive processprobableGO:0022414, GO:0032501, GO:0008150, GO:0000003, GO:0032504
GO:0003705 [MF]RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activityprobableGO:0003700, GO:0003674, GO:0001071, GO:0000981
GO:2000738 [BP]positive regulation of stem cell differentiationprobableGO:2000736, GO:0051094, GO:0050793, GO:0050794, GO:0045597, GO:0045595, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0007605 [BP]sensory perception of soundprobableGO:0032501, GO:0044707, GO:0050954, GO:0007600, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0016477 [BP]cell migrationprobableGO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0008150, GO:0051179, GO:0044699
GO:0006351 [BP]transcription, DNA-dependentprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:0007381 [BP]specification of segmental identity, labial segmentprobableGO:0032502, GO:0007389, GO:0032501, GO:0009880, GO:0044707, GO:0009790, GO:0007380, GO:0048856, GO:0044767, GO:0035289, GO:0060322, GO:0008150, GO:0003002, GO:0007379, GO:0035282, GO:0007350, GO:0007275, GO:0044699, GO:0035287
GO:0001077 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcriptionprobableGO:0003700, GO:0001228, GO:0003674, GO:0001071, GO:0000982, GO:0000981
GO:0007634 [BP]optokinetic behaviorprobableGO:0009628, GO:0007632, GO:0032501, GO:0044704, GO:0044707, GO:0019098, GO:0009314, GO:0050896, GO:0007610, GO:0022414, GO:0044702, GO:0009416, GO:0044708, GO:0008150, GO:0044699, GO:0000003
GO:0000980 [MF]RNA polymerase II distal enhancer sequence-specific DNA bindingprobableGO:0005488, GO:0044212, GO:0043565, GO:0001067, GO:0003677, GO:0001012, GO:0001158, GO:0000976, GO:0000977, GO:0003676, GO:0000975, GO:0003674, GO:0097159, GO:1901363, GO:0035326
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0007417 [BP]central nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0048699 [BP]generation of neuronsprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0009987, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699
GO:0042473 [BP]outer ear morphogenesisprobableGO:0042471, GO:0048598, GO:0009887, GO:0048562, GO:0044707, GO:0007423, GO:0048568, GO:0032501, GO:0048856, GO:0044767, GO:0009790, GO:0048513, GO:0008150, GO:0043583, GO:0048731, GO:0009653, GO:0032502, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R5Y, chain A
Confidence level:very confident
Coverage over the Query: 108-118,137-194
View the alignment between query and template
View the model in PyMOL
Template: 1NK2, chain P
Confidence level:very confident
Coverage over the Query: 3-73
View the alignment between query and template
View the model in PyMOL