Psyllid ID: psy11996


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNNPNLYTQYQTQGKSCTGRYQVRPITSPHGAYHGDLRYHWTNRAPLKYVKRGTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNVIPYHYHMSQPYGNPYQFTHLAT
ccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccHHHHHHcccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccHHHHccccHHHHHHHccccccccccccccccccccccccccccc
ccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHcccccccccccccccccccccccccc
mstvnangetkrqrtSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMasmnnpnlytqyqtqgksctgryqvrpitsphgayhgdlryhwtnraplkyvkrgtvnangetkrqrtsYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASmnvipyhyhmsqpygnpyqfthlat
mstvnangetkrqrtsytryqtlelekefhfnryltrRRRIEIAHalclterqikiwFQNRRMKWKKEHKMASMNNPNLYTQYQTQGKSCTGRYQVRPITSPHGAYHGDLRYHWTnraplkyvkrgtvnangetkrqrtsytryqtlelekefhfnryltrRRRIEIAHalclterqikiwFQNRRMKWKKEHKMASMNVIPYHYHMSQPYGNPYQFTHLAT
MSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNNPNLYTQYQTQGKSCTGRYQVRPITSPHGAYHGDLRYHWTNRAPLKYVKRGTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNVIPYHYHMSQPYGNPYQFTHLAT
****************YTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK**********NLYTQYQTQGKSCTGRYQVRPITSPHGAYHGDLRYHWTNRAPLKYVKRGTVNAN******RTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNVIPYHYHMSQPYGNPYQF*****
*****************TRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNNPNLYTQYQTQGKSCTGRYQVRPITSPHGAYHGDLRYHWTNRAPLKYVKRGTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRM***********************************
***************SYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNNPNLYTQYQTQGKSCTGRYQVRPITSPHGAYHGDLRYHWTNRAPLKYVKRGTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNVIPYHYHMSQPYGNPYQFTHLAT
**************TSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHK**S****************************************************************RTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHK****************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNNPNLYTQYQTQGKSCTGRYQVRPITSPHGAYHGDLRYHWTNRAPLKYVKRGTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASMNVIPYHYHMSQPYGNPYQFTHLAT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query222 2.2.26 [Sep-21-2011]
P09077417 Homeotic protein Sex comb yes N/A 0.472 0.251 0.739 5e-44
P1585986 Homeobox protein H55 (Fra no N/A 0.387 1.0 0.921 6e-41
P17277309 Homeobox protein Hox-A4 O yes N/A 0.391 0.281 0.704 2e-30
Q9IA11252 Homeobox protein Hox-D5 O N/A N/A 0.315 0.277 0.857 3e-30
Q9PWD3281 Homeobox protein Hox-A5 O N/A N/A 0.319 0.252 0.845 4e-30
Q1KKX9319 Homeobox protein Hox-B5a N/A N/A 0.306 0.213 0.852 5e-30
A2D5Y4270 Homeobox protein Hox-A5 O N/A N/A 0.310 0.255 0.840 7e-30
Q1KKX0280 Homeobox protein Hox-B5b N/A N/A 0.310 0.246 0.826 8e-30
Q9IA23275 Homeobox protein Hox-A5 O N/A N/A 0.306 0.247 0.867 9e-30
A2D5K9270 Homeobox protein Hox-A5 O N/A N/A 0.310 0.255 0.840 1e-29
>sp|P09077|SCR_DROME Homeotic protein Sex combs reduced OS=Drosophila melanogaster GN=Scr PE=1 SV=5 Back     alignment and function desciption
 Score =  177 bits (449), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 88/119 (73%), Positives = 94/119 (78%), Gaps = 14/119 (11%)

Query: 112 YHWTNRAPLKYVKRGTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHAL 171
           Y W  R    ++   TVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHAL
Sbjct: 305 YPWMKRV---HLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHAL 361

Query: 172 CLTERQIKIWFQNRRMKWKKEHKMASMNVIPYHYHMSQPYGNPY--------QFTHLAT 222
           CLTERQIKIWFQNRRMKWKKEHKMASMN++PYH     PYG+PY        QF HL+ 
Sbjct: 362 CLTERQIKIWFQNRRMKWKKEHKMASMNIVPYHM---GPYGHPYHQFDIHPSQFAHLSA 417




Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Controls the segmental transformation of the first to the second thoracic segment (prothorax to mesothorax) and of the labial palps into maxillary palps. In embryo, required for fusion of labial lobes and development of the T1 denticle belt. In adult, expression in the head is necessary for proper development of the labium. In the first thoracic segment of the adult, required for proper development of the sex comb and to suppress improper prothoracic wing development.
Drosophila melanogaster (taxid: 7227)
>sp|P15859|SCR_APIME Homeobox protein H55 (Fragment) OS=Apis mellifera PE=3 SV=1 Back     alignment and function description
>sp|P17277|HXA4_CHICK Homeobox protein Hox-A4 OS=Gallus gallus GN=HOXA4 PE=2 SV=1 Back     alignment and function description
>sp|Q9IA11|HXD5_HETFR Homeobox protein Hox-D5 OS=Heterodontus francisci GN=HOXD5 PE=3 SV=1 Back     alignment and function description
>sp|Q9PWD3|HXA5_MORSA Homeobox protein Hox-A5 OS=Morone saxatilis GN=hoxa5 PE=3 SV=1 Back     alignment and function description
>sp|Q1KKX9|HXB5A_TAKRU Homeobox protein Hox-B5a OS=Takifugu rubripes GN=hoxb5a PE=3 SV=1 Back     alignment and function description
>sp|A2D5Y4|HXA5_LEMCA Homeobox protein Hox-A5 OS=Lemur catta GN=HOXA5 PE=3 SV=1 Back     alignment and function description
>sp|Q1KKX0|HXB5B_TAKRU Homeobox protein Hox-B5b OS=Takifugu rubripes GN=hoxb5b PE=3 SV=1 Back     alignment and function description
>sp|Q9IA23|HXA5_HETFR Homeobox protein Hox-A5 OS=Heterodontus francisci GN=HOXA5 PE=3 SV=1 Back     alignment and function description
>sp|A2D5K9|HXA5_LAGLA Homeobox protein Hox-A5 OS=Lagothrix lagotricha GN=HOXA5 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query222
344252749222 Homeobox protein Hox-A5 [Cricetulus gris 0.734 0.734 0.572 1e-55
270065291302 sex combs reduced [Oncopeltus fasciatus] 0.486 0.357 0.882 3e-51
224460203 338 sex combs reduced [Rhodnius prolixus] 0.486 0.319 0.864 5e-50
47213840 369 unnamed protein product [Tetraodon nigro 0.828 0.498 0.539 1e-47
383849607 373 PREDICTED: homeobox protein Hox-A5a-like 0.472 0.281 0.779 2e-44
86515396312 cephalothorax [Tribolium castaneum] gi|1 0.472 0.336 0.779 3e-44
7229537312 sex combs reduced Scr [Tribolium castane 0.472 0.336 0.779 3e-44
201023305 390 sex combs reduced [Nasonia vitripennis] 0.472 0.269 0.779 3e-44
31205335 372 AGAP004659-PA [Anopheles gambiae str. PE 0.450 0.268 0.830 3e-44
54607270312 cephalothorax [Tribolium castaneum] 0.472 0.336 0.779 3e-44
>gi|344252749|gb|EGW08853.1| Homeobox protein Hox-A5 [Cricetulus griseus] Back     alignment and taxonomy information
 Score =  221 bits (564), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 123/215 (57%), Positives = 139/215 (64%), Gaps = 52/215 (24%)

Query: 1   MSTVNANG-ETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQ 59
           +S  N  G E KR RT+YTRYQTLELEKEFHFNRYLTRRRRIEIAHALCL+ERQIKIWFQ
Sbjct: 33  ISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQ 92

Query: 60  NRRMKWKKEHKMASMNNPNLYTQYQTQGKSCTGRYQVRPITSPHGAYHGDLRYHWTNRAP 119
           NRRMKWKK++K+ SM NP                           +Y+G           
Sbjct: 93  NRRMKWKKDNKLKSMINP---------------------------SYNG----------- 114

Query: 120 LKYVKRGTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIK 179
                       GE KR RT+YTR Q LELEKEFHFNRYLTRRRRIEIAH LCL+ERQ+K
Sbjct: 115 ------------GEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVK 162

Query: 180 IWFQNRRMKWKKEHKMASMNVIPYHYHMSQPYGNP 214
           IWFQNRRMKWKK+HK+ +  +   +   S P G P
Sbjct: 163 IWFQNRRMKWKKDHKLPNTKMRSSN-PASAPAGPP 196




Source: Cricetulus griseus

Species: Cricetulus griseus

Genus: Cricetulus

Family: Cricetidae

Order: Rodentia

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|270065291|gb|ACZ60640.1| sex combs reduced [Oncopeltus fasciatus] Back     alignment and taxonomy information
>gi|224460203|gb|ACN43631.1| sex combs reduced [Rhodnius prolixus] Back     alignment and taxonomy information
>gi|47213840|emb|CAG00644.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information
>gi|383849607|ref|XP_003700436.1| PREDICTED: homeobox protein Hox-A5a-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|86515396|ref|NP_001034523.1| cephalothorax [Tribolium castaneum] gi|13241681|gb|AAK16422.1|AF321227_2 Scr [Tribolium castaneum] gi|270002805|gb|EEZ99252.1| sex combs reduced [Tribolium castaneum] Back     alignment and taxonomy information
>gi|7229537|gb|AAF42868.1|AF227628_1 sex combs reduced Scr [Tribolium castaneum] gi|54607266|gb|AAL26542.2| cephalothorax [Tribolium castaneum] gi|54607268|gb|AAL27023.2| cephalothorax [Tribolium castaneum] Back     alignment and taxonomy information
>gi|201023305|ref|NP_001128396.1| sex combs reduced [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|31205335|ref|XP_311616.1| AGAP004659-PA [Anopheles gambiae str. PEST] gi|3420834|gb|AAC31944.1| Sex combs reduced homeotic protein [Anopheles gambiae] gi|30177656|gb|EAA07257.2| AGAP004659-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|54607270|gb|AAL23667.2| cephalothorax [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query222
FB|FBgn0003339417 Scr "Sex combs reduced" [Droso 0.450 0.239 0.813 6.7e-45
UNIPROTKB|F1NMG4309 LOC100858374 "Uncharacterized 0.391 0.281 0.704 1e-29
UNIPROTKB|P17277309 HOXA4 "Homeobox protein Hox-A4 0.391 0.281 0.704 1e-29
UNIPROTKB|P14840245 HOXB4 "Homeobox protein Hox-B4 0.423 0.383 0.625 7.1e-29
UNIPROTKB|E2QT52274 HOXB4 "Uncharacterized protein 0.427 0.346 0.625 9.1e-29
UNIPROTKB|F6UWC1251 HOXB4 "Uncharacterized protein 0.427 0.378 0.625 9.1e-29
UNIPROTKB|F1RWG5251 HOXB4 "Uncharacterized protein 0.427 0.378 0.625 9.1e-29
UNIPROTKB|F1N257251 HOXB4 "Homeobox protein Hox-B4 0.427 0.378 0.625 9.1e-29
UNIPROTKB|Q08DG5251 HOXB4 "Homeobox protein Hox-B4 0.427 0.378 0.625 9.1e-29
UNIPROTKB|P17483251 HOXB4 "Homeobox protein Hox-B4 0.427 0.378 0.625 9.1e-29
FB|FBgn0003339 Scr "Sex combs reduced" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 446 (162.1 bits), Expect = 6.7e-45, Sum P(2) = 6.7e-45
 Identities = 87/107 (81%), Positives = 92/107 (85%)

Query:   112 YHWTNRAPLKYVKRGTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHAL 171
             Y W  R    ++   TVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHAL
Sbjct:   305 YPWMKRV---HLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHAL 361

Query:   172 CLTERQIKIWFQNRRMKWKKEHKMASMNVIPYHYHMSQPYGNPY-QF 217
             CLTERQIKIWFQNRRMKWKKEHKMASMN++PYH  M  PYG+PY QF
Sbjct:   362 CLTERQIKIWFQNRRMKWKKEHKMASMNIVPYH--MG-PYGHPYHQF 405


GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IDA;IMP
GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=ISS
GO:0005634 "nucleus" evidence=ISS;NAS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS;NAS
GO:0007494 "midgut development" evidence=TAS
GO:0007379 "segment specification" evidence=NAS
GO:0007381 "specification of segmental identity, labial segment" evidence=TAS
GO:0045498 "sex comb development" evidence=IMP;NAS
GO:0007548 "sex differentiation" evidence=TAS
GO:0007432 "salivary gland boundary specification" evidence=NAS;TAS
GO:0000977 "RNA polymerase II regulatory region sequence-specific DNA binding" evidence=IDA
GO:0043565 "sequence-specific DNA binding" evidence=IDA
GO:0042803 "protein homodimerization activity" evidence=IDA
UNIPROTKB|F1NMG4 LOC100858374 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P17277 HOXA4 "Homeobox protein Hox-A4" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P14840 HOXB4 "Homeobox protein Hox-B4" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2QT52 HOXB4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6UWC1 HOXB4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RWG5 HOXB4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1N257 HOXB4 "Homeobox protein Hox-B4" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q08DG5 HOXB4 "Homeobox protein Hox-B4" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P17483 HOXB4 "Homeobox protein Hox-B4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P15859SCR_APIMENo assigned EC number0.92130.38731.0noN/A
P09077SCR_DROMENo assigned EC number0.73940.47290.2517yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
pfam0004657 pfam00046, Homeobox, Homeobox domain 5e-24
pfam0004657 pfam00046, Homeobox, Homeobox domain 5e-24
smart0038957 smart00389, HOX, Homeodomain 1e-19
smart0038957 smart00389, HOX, Homeodomain 1e-19
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 2e-19
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 2e-19
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 3e-07
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 3e-07
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
 Score = 89.8 bits (224), Expect = 5e-24
 Identities = 33/57 (57%), Positives = 42/57 (73%)

Query: 11 KRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK 67
          +R+RT++T  Q  ELEKEF  NRY +   R E+A  L LTERQ+K+WFQNRR KWK+
Sbjct: 1  RRKRTTFTPEQLEELEKEFEKNRYPSAEEREELAKKLGLTERQVKVWFQNRRAKWKR 57


Length = 57

>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 222
KOG0484|consensus125 99.81
KOG0490|consensus235 99.8
KOG0850|consensus245 99.73
KOG0489|consensus261 99.72
KOG2251|consensus228 99.71
KOG0850|consensus245 99.7
KOG0484|consensus125 99.69
KOG0489|consensus261 99.69
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.69
KOG0842|consensus307 99.67
KOG0843|consensus197 99.67
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.67
KOG0488|consensus309 99.66
KOG0488|consensus309 99.66
KOG0842|consensus307 99.66
KOG0485|consensus268 99.65
KOG0843|consensus197 99.65
KOG0494|consensus332 99.64
KOG2251|consensus 228 99.63
KOG0485|consensus268 99.6
KOG0492|consensus246 99.59
KOG0487|consensus308 99.57
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.56
KOG0487|consensus308 99.56
KOG0492|consensus246 99.56
KOG0848|consensus317 99.56
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.54
KOG0494|consensus 332 99.54
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.54
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.53
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.52
KOG0493|consensus342 99.52
KOG0848|consensus317 99.51
KOG0491|consensus194 99.5
KOG0493|consensus342 99.49
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.49
KOG3802|consensus398 99.48
KOG0844|consensus408 99.45
KOG0491|consensus194 99.45
KOG0486|consensus351 99.45
COG5576156 Homeodomain-containing transcription factor [Trans 99.43
KOG3802|consensus398 99.42
KOG4577|consensus383 99.42
COG5576156 Homeodomain-containing transcription factor [Trans 99.4
KOG0844|consensus 408 99.39
KOG0483|consensus198 99.37
KOG0483|consensus198 99.35
KOG4577|consensus 383 99.35
KOG0847|consensus288 99.33
KOG0486|consensus 351 99.31
KOG0847|consensus288 99.3
KOG1168|consensus385 99.02
KOG0849|consensus354 99.02
KOG0775|consensus304 98.96
KOG0775|consensus304 98.96
KOG1168|consensus385 98.95
KOG0490|consensus235 98.93
KOG0849|consensus354 98.84
KOG0774|consensus334 98.78
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.74
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.67
KOG0774|consensus334 98.51
KOG1146|consensus 1406 98.51
KOG2252|consensus558 98.45
KOG2252|consensus558 98.33
KOG0773|consensus342 98.04
KOG1146|consensus 1406 98.0
KOG3623|consensus 1007 97.69
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 97.61
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 97.53
KOG0773|consensus342 96.32
KOG3623|consensus 1007 96.13
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 95.39
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 94.41
KOG3755|consensus769 92.12
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 87.79
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 85.78
PF0152776 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transp 84.03
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 83.86
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 80.99
>KOG0484|consensus Back     alignment and domain information
Probab=99.81  E-value=4.9e-20  Score=125.75  Aligned_cols=70  Identities=37%  Similarity=0.562  Sum_probs=64.9

Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHhhhCCCCCHHHHHHHHHHhCCChHHHHHHhhcchhHHHHHhhhhcc
Q psy11996          5 NANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASM   74 (222)
Q Consensus         5 ~~~~~~~r~R~~~t~~q~~~L~~~f~~~~~p~~~~~~~la~~~~l~~~~v~~WF~nrR~k~~~~~~~~~~   74 (222)
                      ...+++||-||+||..||..||..|.+.+||++..|++||.++.|++.+|++||||||+|.+++++....
T Consensus        12 ~ekrKQRRIRTTFTS~QLkELErvF~ETHYPDIYTREEiA~kidLTEARVQVWFQNRRAKfRKQEr~a~~   81 (125)
T KOG0484|consen   12 TEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREEIALKIDLTEARVQVWFQNRRAKFRKQERAAIA   81 (125)
T ss_pred             hHHHHhhhhhhhhhHHHHHHHHHHHHhhcCCcchhHHHHHHhhhhhHHHHHHHHHhhHHHHHHHHHHHHH
Confidence            3456789999999999999999999999999999999999999999999999999999999998876643



>KOG0490|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>KOG3755|consensus Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PF01527 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
2r5y_A88 Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HO 3e-33
2r5y_A88 Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HO 5e-33
1hom_A68 Determination Of The Three-Dimensional Structure Of 4e-26
1hom_A68 Determination Of The Three-Dimensional Structure Of 4e-26
1ahd_P68 Determination Of The Nmr Solution Structure Of An A 4e-25
1ahd_P68 Determination Of The Nmr Solution Structure Of An A 4e-25
9ant_A62 Antennapedia Homeodomain-Dna Complex Length = 62 5e-25
9ant_A62 Antennapedia Homeodomain-Dna Complex Length = 62 5e-25
1san_A62 The Des(1-6)antennapedia Homeodomain: Comparison Of 5e-24
1san_A62 The Des(1-6)antennapedia Homeodomain: Comparison Of 5e-24
1b8i_A81 Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX 6e-23
1b8i_A81 Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX 3e-22
1ftz_A70 Nuclear Magnetic Resonance Solution Structure Of Th 6e-23
1ftz_A70 Nuclear Magnetic Resonance Solution Structure Of Th 6e-23
2h1k_A63 Crystal Structure Of The Pdx1 Homeodomain In Comple 6e-19
2h1k_A63 Crystal Structure Of The Pdx1 Homeodomain In Comple 6e-19
2lp0_A60 The Solution Structure Of Homeodomain-Protein Compl 3e-17
2lp0_A60 The Solution Structure Of Homeodomain-Protein Compl 3e-17
1puf_A77 Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bo 1e-16
1puf_A77 Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bo 1e-16
2m34_A71 Nmr Structure Of The Homeodomain Transcription Fact 3e-15
2m34_A71 Nmr Structure Of The Homeodomain Transcription Fact 3e-15
1b72_A97 Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Le 5e-15
1b72_A97 Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Le 5e-15
3a01_A93 Crystal Structure Of Aristaless And Clawless Homeod 7e-11
3a01_A93 Crystal Structure Of Aristaless And Clawless Homeod 7e-11
2dmt_A80 Solution Structure Of The Homeobox Domain Of Homeob 8e-11
2cra_A70 Solution Structure Of The Homeobox Domain Of Human 2e-10
1hdd_C61 Crystal Structure Of An Engrailed Homeodomain-Dna C 3e-10
1hdd_C61 Crystal Structure Of An Engrailed Homeodomain-Dna C 3e-10
3hdd_A60 Engrailed Homeodomain Dna Complex Length = 60 5e-10
3hdd_A60 Engrailed Homeodomain Dna Complex Length = 60 5e-10
1ztr_A61 Solution Structure Of Engrailed Homeodomain L16a Mu 8e-10
1ztr_A61 Solution Structure Of Engrailed Homeodomain L16a Mu 8e-10
1p7j_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 9e-10
1p7j_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 9e-10
1p7i_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 1e-09
1p7i_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 1e-09
2hdd_A61 Engrailed Homeodomain Q50k Variant Dna Complex Leng 1e-09
2hdd_A61 Engrailed Homeodomain Q50k Variant Dna Complex Leng 1e-09
1jgg_A60 Even-Skipped Homeodomain Complexed To At-Rich Dna L 2e-09
1jgg_A60 Even-Skipped Homeodomain Complexed To At-Rich Dna L 2e-09
3a03_A56 Crystal Structure Of Hox11l1 Homeodomain Length = 5 5e-09
3a03_A56 Crystal Structure Of Hox11l1 Homeodomain Length = 5 5e-09
2l7z_A73 Nmr Structure Of A13 Homedomain Length = 73 6e-09
2l7z_A73 Nmr Structure Of A13 Homedomain Length = 73 6e-09
1du0_A57 Engrailed Homeodomain Q50a Variant Dna Complex Leng 6e-09
1du0_A57 Engrailed Homeodomain Q50a Variant Dna Complex Leng 6e-09
1enh_A54 Structural Studies Of The Engrailed Homeodomain Len 9e-09
1enh_A54 Structural Studies Of The Engrailed Homeodomain Len 9e-09
2ld5_A67 Solution Nmr-Derived Complex Structure Of Hoxa13 Dn 1e-08
2ld5_A67 Solution Nmr-Derived Complex Structure Of Hoxa13 Dn 1e-08
2djn_A70 The Solution Structure Of The Homeobox Domain Of Hu 1e-08
2e1o_A70 Solution Structure Of Rsgi Ruh-028, A Homeobox Doma 2e-08
2e1o_A70 Solution Structure Of Rsgi Ruh-028, A Homeobox Doma 2e-08
2hos_A63 Phage-selected Homeodomain Bound To Unmodified Dna 2e-08
2hos_A63 Phage-selected Homeodomain Bound To Unmodified Dna 2e-08
2m0c_A75 Solution Nmr Structure Of Homeobox Domain Of Human 3e-08
2m0c_A75 Solution Nmr Structure Of Homeobox Domain Of Human 4e-08
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 6e-08
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 6e-08
1ig7_A58 Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 6e-08
1ig7_A58 Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 6e-08
2l7f_P68 Solution Structure Of The Pitx2 Homeodomain Length 8e-08
2l7f_P68 Solution Structure Of The Pitx2 Homeodomain Length 8e-08
2cue_A80 Solution Structure Of The Homeobox Domain Of The Hu 1e-07
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 3e-07
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 3e-07
2p81_A44 Engrailed Homeodomain Helix-Turn-Helix Motif Length 4e-07
2p81_A44 Engrailed Homeodomain Helix-Turn-Helix Motif Length 4e-07
2l7m_P68 Solution Structure Of The Pitx2 Homeodomain R24h Mu 4e-07
2l7m_P68 Solution Structure Of The Pitx2 Homeodomain R24h Mu 4e-07
3a02_A60 Crystal Structure Of Aristaless Homeodomain Length 7e-07
3a02_A60 Crystal Structure Of Aristaless Homeodomain Length 7e-07
1zq3_P68 Nmr Solution Structure Of The Bicoid Homeodomain Bo 2e-06
1zq3_P68 Nmr Solution Structure Of The Bicoid Homeodomain Bo 2e-06
2l9r_A69 Solution Nmr Structure Of Homeobox Domain Of Homeob 3e-06
2l9r_A69 Solution Nmr Structure Of Homeobox Domain Of Homeob 3e-06
3rkq_A58 Nkx2.5 Homeodomain Dimer Bound To Anf-242 Dna Lengt 3e-06
3rkq_A58 Nkx2.5 Homeodomain Dimer Bound To Anf-242 Dna Lengt 3e-06
1nk2_P77 VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES 7e-06
1nk2_P77 VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES 7e-06
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 1e-05
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 1e-05
1qry_A80 Homeobox Protein Vnd (Ventral Nervous System Defect 1e-05
1qry_A80 Homeobox Protein Vnd (Ventral Nervous System Defect 2e-05
3cmy_A61 Structure Of A Homeodomain In Complex With Dna Leng 6e-05
3cmy_A61 Structure Of A Homeodomain In Complex With Dna Leng 6e-05
2vi6_A62 Crystal Structure Of The Nanog Homeodomain Length = 6e-05
2vi6_A62 Crystal Structure Of The Nanog Homeodomain Length = 6e-05
1ftt_A68 Thyroid Transcription Factor 1 Homeodomain (Rattus 8e-05
1ftt_A68 Thyroid Transcription Factor 1 Homeodomain (Rattus 8e-05
2dms_A80 Solution Structure Of The Homeobox Domain Of Homeob 9e-05
2dmu_A70 Solution Structure Of The Homeobox Domain Of Homeob 3e-04
2k40_A67 Nmr Structure Of Hesx-1 Homeodomain Double Mutant R 4e-04
2k40_A67 Nmr Structure Of Hesx-1 Homeodomain Double Mutant R 4e-04
2kt0_A84 Solution Structure Of Human Stem Cell Transcription 4e-04
2kt0_A84 Solution Structure Of Human Stem Cell Transcription 4e-04
>pdb|2R5Y|A Chain A, Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HOX-Exd Site Length = 88 Back     alignment and structure

Iteration: 1

Score = 138 bits (347), Expect = 3e-33, Method: Compositional matrix adjust. Identities = 68/69 (98%), Positives = 68/69 (98%) Query: 2 STVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNR 61 STVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHAL LTERQIKIWFQNR Sbjct: 20 STVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNR 79 Query: 62 RMKWKKEHK 70 RMKWKKEHK Sbjct: 80 RMKWKKEHK 88
>pdb|2R5Y|A Chain A, Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HOX-Exd Site Length = 88 Back     alignment and structure
>pdb|1HOM|A Chain A, Determination Of The Three-Dimensional Structure Of The Antennapedia Homeodomain From Drosophila In Solution By 1h Nuclear Magnetic Resonance Spectroscopy Length = 68 Back     alignment and structure
>pdb|1HOM|A Chain A, Determination Of The Three-Dimensional Structure Of The Antennapedia Homeodomain From Drosophila In Solution By 1h Nuclear Magnetic Resonance Spectroscopy Length = 68 Back     alignment and structure
>pdb|1AHD|P Chain P, Determination Of The Nmr Solution Structure Of An Antennapedia Homeodomain-Dna Complex Length = 68 Back     alignment and structure
>pdb|1AHD|P Chain P, Determination Of The Nmr Solution Structure Of An Antennapedia Homeodomain-Dna Complex Length = 68 Back     alignment and structure
>pdb|9ANT|A Chain A, Antennapedia Homeodomain-Dna Complex Length = 62 Back     alignment and structure
>pdb|9ANT|A Chain A, Antennapedia Homeodomain-Dna Complex Length = 62 Back     alignment and structure
>pdb|1SAN|A Chain A, The Des(1-6)antennapedia Homeodomain: Comparison Of The Nmr Solution Structure And The Dna Binding Affinity With The Intact Antennapedia Homeodomain Length = 62 Back     alignment and structure
>pdb|1SAN|A Chain A, The Des(1-6)antennapedia Homeodomain: Comparison Of The Nmr Solution Structure And The Dna Binding Affinity With The Intact Antennapedia Homeodomain Length = 62 Back     alignment and structure
>pdb|1B8I|A Chain A, Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX Length = 81 Back     alignment and structure
>pdb|1B8I|A Chain A, Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX Length = 81 Back     alignment and structure
>pdb|1FTZ|A Chain A, Nuclear Magnetic Resonance Solution Structure Of The Fushi Tarazu Homeodomain From Drosophila And Comparison With The Antennapedia Homeodomain Length = 70 Back     alignment and structure
>pdb|1FTZ|A Chain A, Nuclear Magnetic Resonance Solution Structure Of The Fushi Tarazu Homeodomain From Drosophila And Comparison With The Antennapedia Homeodomain Length = 70 Back     alignment and structure
>pdb|2H1K|A Chain A, Crystal Structure Of The Pdx1 Homeodomain In Complex With Dna Length = 63 Back     alignment and structure
>pdb|2H1K|A Chain A, Crystal Structure Of The Pdx1 Homeodomain In Complex With Dna Length = 63 Back     alignment and structure
>pdb|2LP0|A Chain A, The Solution Structure Of Homeodomain-Protein Complex Length = 60 Back     alignment and structure
>pdb|2LP0|A Chain A, The Solution Structure Of Homeodomain-Protein Complex Length = 60 Back     alignment and structure
>pdb|1PUF|A Chain A, Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bound To Dna Length = 77 Back     alignment and structure
>pdb|1PUF|A Chain A, Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bound To Dna Length = 77 Back     alignment and structure
>pdb|2M34|A Chain A, Nmr Structure Of The Homeodomain Transcription Factor Gbx1 From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2M34|A Chain A, Nmr Structure Of The Homeodomain Transcription Factor Gbx1 From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|1B72|A Chain A, Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Length = 97 Back     alignment and structure
>pdb|1B72|A Chain A, Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Length = 97 Back     alignment and structure
>pdb|3A01|A Chain A, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 93 Back     alignment and structure
>pdb|3A01|A Chain A, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 93 Back     alignment and structure
>pdb|2DMT|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Barh-Like 1 Length = 80 Back     alignment and structure
>pdb|2CRA|A Chain A, Solution Structure Of The Homeobox Domain Of Human Homeo Box B13 Length = 70 Back     alignment and structure
>pdb|1HDD|C Chain C, Crystal Structure Of An Engrailed Homeodomain-Dna Complex At 2.8 Angstroms Resolution: A Framework For Understanding Homeodomain-Dna Interactions Length = 61 Back     alignment and structure
>pdb|1HDD|C Chain C, Crystal Structure Of An Engrailed Homeodomain-Dna Complex At 2.8 Angstroms Resolution: A Framework For Understanding Homeodomain-Dna Interactions Length = 61 Back     alignment and structure
>pdb|3HDD|A Chain A, Engrailed Homeodomain Dna Complex Length = 60 Back     alignment and structure
>pdb|3HDD|A Chain A, Engrailed Homeodomain Dna Complex Length = 60 Back     alignment and structure
>pdb|1ZTR|A Chain A, Solution Structure Of Engrailed Homeodomain L16a Mutant Length = 61 Back     alignment and structure
>pdb|1ZTR|A Chain A, Solution Structure Of Engrailed Homeodomain L16a Mutant Length = 61 Back     alignment and structure
>pdb|1P7J|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52e Length = 59 Back     alignment and structure
>pdb|1P7J|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52e Length = 59 Back     alignment and structure
>pdb|1P7I|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52a Length = 59 Back     alignment and structure
>pdb|1P7I|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52a Length = 59 Back     alignment and structure
>pdb|2HDD|A Chain A, Engrailed Homeodomain Q50k Variant Dna Complex Length = 61 Back     alignment and structure
>pdb|2HDD|A Chain A, Engrailed Homeodomain Q50k Variant Dna Complex Length = 61 Back     alignment and structure
>pdb|1JGG|A Chain A, Even-Skipped Homeodomain Complexed To At-Rich Dna Length = 60 Back     alignment and structure
>pdb|1JGG|A Chain A, Even-Skipped Homeodomain Complexed To At-Rich Dna Length = 60 Back     alignment and structure
>pdb|3A03|A Chain A, Crystal Structure Of Hox11l1 Homeodomain Length = 56 Back     alignment and structure
>pdb|3A03|A Chain A, Crystal Structure Of Hox11l1 Homeodomain Length = 56 Back     alignment and structure
>pdb|2L7Z|A Chain A, Nmr Structure Of A13 Homedomain Length = 73 Back     alignment and structure
>pdb|2L7Z|A Chain A, Nmr Structure Of A13 Homedomain Length = 73 Back     alignment and structure
>pdb|1DU0|A Chain A, Engrailed Homeodomain Q50a Variant Dna Complex Length = 57 Back     alignment and structure
>pdb|1DU0|A Chain A, Engrailed Homeodomain Q50a Variant Dna Complex Length = 57 Back     alignment and structure
>pdb|1ENH|A Chain A, Structural Studies Of The Engrailed Homeodomain Length = 54 Back     alignment and structure
>pdb|1ENH|A Chain A, Structural Studies Of The Engrailed Homeodomain Length = 54 Back     alignment and structure
>pdb|2LD5|A Chain A, Solution Nmr-Derived Complex Structure Of Hoxa13 Dna Binding Domain Bound To Dna Length = 67 Back     alignment and structure
>pdb|2LD5|A Chain A, Solution Nmr-Derived Complex Structure Of Hoxa13 Dna Binding Domain Bound To Dna Length = 67 Back     alignment and structure
>pdb|2DJN|A Chain A, The Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Dlx-5 Length = 70 Back     alignment and structure
>pdb|2E1O|A Chain A, Solution Structure Of Rsgi Ruh-028, A Homeobox Domain From Human Cdna Length = 70 Back     alignment and structure
>pdb|2E1O|A Chain A, Solution Structure Of Rsgi Ruh-028, A Homeobox Domain From Human Cdna Length = 70 Back     alignment and structure
>pdb|2HOS|A Chain A, Phage-selected Homeodomain Bound To Unmodified Dna Length = 63 Back     alignment and structure
>pdb|2HOS|A Chain A, Phage-selected Homeodomain Bound To Unmodified Dna Length = 63 Back     alignment and structure
>pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 Back     alignment and structure
>pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 Back     alignment and structure
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure
>pdb|1IG7|A Chain A, Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 Back     alignment and structure
>pdb|1IG7|A Chain A, Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 Back     alignment and structure
>pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 Back     alignment and structure
>pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 Back     alignment and structure
>pdb|2CUE|A Chain A, Solution Structure Of The Homeobox Domain Of The Human Paired Box Protein Pax-6 Length = 80 Back     alignment and structure
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure
>pdb|2P81|A Chain A, Engrailed Homeodomain Helix-Turn-Helix Motif Length = 44 Back     alignment and structure
>pdb|2P81|A Chain A, Engrailed Homeodomain Helix-Turn-Helix Motif Length = 44 Back     alignment and structure
>pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 Back     alignment and structure
>pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 Back     alignment and structure
>pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 Back     alignment and structure
>pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 Back     alignment and structure
>pdb|1ZQ3|P Chain P, Nmr Solution Structure Of The Bicoid Homeodomain Bound To The Consensus Dna Binding Site Taatcc Length = 68 Back     alignment and structure
>pdb|1ZQ3|P Chain P, Nmr Solution Structure Of The Bicoid Homeodomain Bound To The Consensus Dna Binding Site Taatcc Length = 68 Back     alignment and structure
>pdb|2L9R|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Homeobox Protein Nkx-3.1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr6470a Length = 69 Back     alignment and structure
>pdb|2L9R|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Homeobox Protein Nkx-3.1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr6470a Length = 69 Back     alignment and structure
>pdb|3RKQ|A Chain A, Nkx2.5 Homeodomain Dimer Bound To Anf-242 Dna Length = 58 Back     alignment and structure
>pdb|3RKQ|A Chain A, Nkx2.5 Homeodomain Dimer Bound To Anf-242 Dna Length = 58 Back     alignment and structure
>pdb|1NK2|P Chain P, VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES Length = 77 Back     alignment and structure
>pdb|1NK2|P Chain P, VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES Length = 77 Back     alignment and structure
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure
>pdb|1QRY|A Chain A, Homeobox Protein Vnd (Ventral Nervous System Defective Protein) Length = 80 Back     alignment and structure
>pdb|1QRY|A Chain A, Homeobox Protein Vnd (Ventral Nervous System Defective Protein) Length = 80 Back     alignment and structure
>pdb|3CMY|A Chain A, Structure Of A Homeodomain In Complex With Dna Length = 61 Back     alignment and structure
>pdb|3CMY|A Chain A, Structure Of A Homeodomain In Complex With Dna Length = 61 Back     alignment and structure
>pdb|2VI6|A Chain A, Crystal Structure Of The Nanog Homeodomain Length = 62 Back     alignment and structure
>pdb|2VI6|A Chain A, Crystal Structure Of The Nanog Homeodomain Length = 62 Back     alignment and structure
>pdb|1FTT|A Chain A, Thyroid Transcription Factor 1 Homeodomain (Rattus Norvegicus) Length = 68 Back     alignment and structure
>pdb|1FTT|A Chain A, Thyroid Transcription Factor 1 Homeodomain (Rattus Norvegicus) Length = 68 Back     alignment and structure
>pdb|2DMS|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Otx2 Length = 80 Back     alignment and structure
>pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 Back     alignment and structure
>pdb|2K40|A Chain A, Nmr Structure Of Hesx-1 Homeodomain Double Mutant R31lE42L Length = 67 Back     alignment and structure
>pdb|2K40|A Chain A, Nmr Structure Of Hesx-1 Homeodomain Double Mutant R31lE42L Length = 67 Back     alignment and structure
>pdb|2KT0|A Chain A, Solution Structure Of Human Stem Cell Transcription Factor Nanog Homeodomain Fragment Length = 84 Back     alignment and structure
>pdb|2KT0|A Chain A, Solution Structure Of Human Stem Cell Transcription Factor Nanog Homeodomain Fragment Length = 84 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query222
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 9e-40
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 2e-38
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 5e-39
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 6e-39
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 2e-38
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 2e-38
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 7e-36
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 7e-36
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 1e-35
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 1e-35
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 4e-35
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 4e-35
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 1e-34
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 1e-34
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 4e-34
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 4e-34
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 4e-34
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 4e-34
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 7e-34
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 7e-34
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 1e-33
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 1e-33
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 5e-33
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 5e-33
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 7e-32
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 7e-32
3a01_A93 Homeodomain-containing protein; homeodomain, prote 3e-31
3a01_A93 Homeodomain-containing protein; homeodomain, prote 3e-31
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 3e-29
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 3e-29
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 2e-28
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 2e-28
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 8e-27
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 8e-27
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 2e-26
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 2e-26
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 4e-26
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 4e-26
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 7e-26
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 7e-26
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 1e-25
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 3e-25
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 8e-24
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 8e-24
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 4e-23
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 4e-23
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 3e-22
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 3e-22
1e3o_C160 Octamer-binding transcription factor 1; transcript 4e-22
1e3o_C160 Octamer-binding transcription factor 1; transcript 4e-22
2xsd_C164 POU domain, class 3, transcription factor 1; trans 4e-19
2xsd_C164 POU domain, class 3, transcription factor 1; trans 4e-19
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 1e-17
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 1e-17
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 1e-16
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 1e-16
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 2e-16
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 2e-16
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-16
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-16
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 3e-15
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 3e-15
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 8e-15
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 8e-15
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 8e-15
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 8e-15
3d1n_I151 POU domain, class 6, transcription factor 1; prote 2e-14
3d1n_I151 POU domain, class 6, transcription factor 1; prote 2e-14
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 1e-13
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 1e-13
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 1e-13
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 3e-13
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 2e-13
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 3e-13
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 2e-13
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 2e-13
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 4e-13
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 4e-13
3a02_A60 Homeobox protein aristaless; homeodomain, developm 7e-13
3a02_A60 Homeobox protein aristaless; homeodomain, developm 7e-13
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 1e-12
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 2e-12
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 1e-12
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 1e-12
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 2e-12
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 2e-12
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 3e-12
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 3e-12
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 1e-11
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 1e-11
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 4e-11
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 7e-11
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 4e-11
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 4e-11
1uhs_A72 HOP, homeodomain only protein; structural genomics 8e-11
1uhs_A72 HOP, homeodomain only protein; structural genomics 8e-11
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 2e-10
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 2e-10
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 2e-10
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 2e-10
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 7e-10
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 1e-09
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 7e-08
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 7e-08
1lfb_A99 Liver transcription factor (LFB1); transcription r 2e-06
1lfb_A99 Liver transcription factor (LFB1); transcription r 3e-06
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 6e-06
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 6e-06
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 1e-05
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 5e-05
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 7e-05
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 7e-05
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 1e-04
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 1e-04
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
 Score =  130 bits (329), Expect = 9e-40
 Identities = 52/70 (74%), Positives = 57/70 (81%)

Query: 1  MSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQN 60
          M+    NG  +R R +YTRYQTLELEKEFH N YLTRRRRIE+AHAL LTERQIKIWFQN
Sbjct: 11 MAIAGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALSLTERQIKIWFQN 70

Query: 61 RRMKWKKEHK 70
          RRMK KKE +
Sbjct: 71 RRMKLKKEIQ 80


>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query222
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.81
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.81
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.81
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.8
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.8
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.8
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.8
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.8
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.8
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.8
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.8
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.79
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.79
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.79
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.79
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.79
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.79
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.79
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.79
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.79
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.79
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.78
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.78
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.78
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.78
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.78
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.78
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.78
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.78
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.78
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.78
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.78
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.78
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.78
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.78
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.78
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.78
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.78
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.78
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.77
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.77
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.77
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.77
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.77
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.77
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.77
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.77
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.77
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.77
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.77
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.77
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.77
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.76
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.76
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.76
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.76
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.76
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.76
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.76
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.76
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.76
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.76
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.76
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.76
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.76
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.75
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.75
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.75
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.75
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.75
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.75
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.75
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.75
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.75
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.75
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.75
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.75
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.75
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.75
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.75
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.75
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.75
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.74
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.74
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.74
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.74
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.74
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.74
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.74
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.74
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.74
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.74
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.73
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.73
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.73
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.73
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.72
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.72
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.72
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.72
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.72
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.71
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.71
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.71
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.71
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.71
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.71
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.7
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.7
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.7
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.7
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.69
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.69
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.69
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.68
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.68
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.68
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.68
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.68
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.67
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.67
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.67
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.67
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.67
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.65
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.65
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.65
2e19_A64 Transcription factor 8; homeobox domain, structura 99.65
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.65
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.65
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.65
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.64
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.64
2e19_A64 Transcription factor 8; homeobox domain, structura 99.63
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.63
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.63
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.63
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.62
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.61
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.61
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.6
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.58
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.56
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.56
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.5
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.49
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.47
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.47
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.45
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.41
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.4
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.32
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.15
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.14
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.5
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.36
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 96.82
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 96.73
1u78_A141 TC3 transposase, transposable element TC3 transpos 91.06
2k27_A159 Paired box protein PAX-8; paired domain, solution 90.08
1pdn_C128 Protein (PRD paired); protein-DNA complex, double 87.82
2glo_A59 Brinker CG9653-PA; protein-DNA complex, helix-turn 85.87
2elh_A87 CG11849-PA, LD40883P; structural genomics, NPPSFA, 85.54
2glo_A59 Brinker CG9653-PA; protein-DNA complex, helix-turn 84.68
1k78_A149 Paired box protein PAX5; paired domain, ETS domain 84.04
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.81  E-value=5.6e-20  Score=120.64  Aligned_cols=65  Identities=31%  Similarity=0.596  Sum_probs=61.1

Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHhhhCCCCCHHHHHHHHHHhCCChHHHHHHhhcchhHHHHHhh
Q psy11996          6 ANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHK   70 (222)
Q Consensus         6 ~~~~~~r~R~~~t~~q~~~L~~~f~~~~~p~~~~~~~la~~~~l~~~~v~~WF~nrR~k~~~~~~   70 (222)
                      .+...+|.|+.||.+|+.+|+..|..++||+..+++.||..+||++.+|++||+|||+++++...
T Consensus         3 ~~~~~rr~Rt~ft~~q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~~WFqNrR~k~rr~~~   67 (70)
T 2dmu_A            3 SGSSGRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRSGP   67 (70)
T ss_dssp             STTSSCCCCCCCCHHHHHHHHHHHHHCSSCCHHHHHHHHHHHTCCHHHHHHHHHHHHHHHHHTST
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHccCCCCHHHHHHHHHHHCCCHHHeehccccccccccccCC
Confidence            45678899999999999999999999999999999999999999999999999999999998654



>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 Back     alignment and structure
>2k27_A Paired box protein PAX-8; paired domain, solution structure, triple frequency, 3D NMR, induced FIT, alternative splicing, developmental protein; NMR {Homo sapiens} Back     alignment and structure
>1pdn_C Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} SCOP: a.4.1.5 Back     alignment and structure
>2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} Back     alignment and structure
>2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} Back     alignment and structure
>2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} Back     alignment and structure
>1k78_A Paired box protein PAX5; paired domain, ETS domain, transcription factor, transcription/DNA complex; 2.25A {Homo sapiens} SCOP: a.4.1.5 a.4.1.5 PDB: 1mdm_A 6pax_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 222
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 1e-21
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 1e-21
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 2e-21
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 2e-21
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 5e-21
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 5e-21
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 6e-19
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 6e-19
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 2e-18
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 2e-18
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 3e-18
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 3e-18
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 3e-17
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 3e-17
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 5e-17
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 5e-17
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 6e-17
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 6e-17
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 8e-17
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 8e-17
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 3e-16
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 3e-16
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 4e-16
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 4e-16
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 6e-16
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 6e-16
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 7e-16
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 2e-15
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 1e-15
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 1e-15
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 1e-15
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 1e-15
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 2e-15
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 2e-15
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 4e-15
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 4e-15
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 8e-15
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 8e-15
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 8e-15
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 8e-15
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 9e-15
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 9e-15
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 4e-14
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 4e-14
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 1e-13
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 1e-13
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 3e-13
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 3e-13
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 4e-13
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 4e-13
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 5e-13
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 2e-12
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 7e-13
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 9e-13
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 1e-12
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 1e-12
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 3e-12
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 3e-12
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 3e-11
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 3e-11
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 1e-10
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 1e-10
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 7e-09
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 7e-09
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Antennapedia Homeodomain
species: Drosophila melanogaster [TaxId: 7227]
 Score = 82.1 bits (203), Expect = 1e-21
 Identities = 52/56 (92%), Positives = 54/56 (96%)

Query: 14 RTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEH 69
          R +YTRYQTLELEKEFHFNRYLTRRRRIEIAHAL LTERQIKIWFQNRRMKWKKE+
Sbjct: 1  RQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEN 56


>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query222
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.86
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.84
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.84
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.84
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.84
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.84
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.84
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.83
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.83
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.83
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.83
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.83
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.83
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.82
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.82
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.82
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.82
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.82
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.82
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.81
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.81
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.81
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.81
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.81
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.8
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.8
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.8
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.8
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.79
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.79
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.79
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.78
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.78
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.78
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.77
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.77
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.77
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.77
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.77
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.76
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.75
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.75
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.75
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.75
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.74
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.73
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.72
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.72
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.71
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.7
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.7
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.7
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.7
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.67
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.65
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.65
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.65
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.63
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.63
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.61
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.61
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.6
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.6
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.59
d1hlva166 DNA-binding domain of centromere binding protein B 92.3
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 92.08
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 90.71
d1hlva166 DNA-binding domain of centromere binding protein B 90.37
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-b13
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.86  E-value=2.2e-22  Score=124.68  Aligned_cols=58  Identities=47%  Similarity=0.785  Sum_probs=55.4

Q ss_pred             CCCCCCCCCHHHHHHHHHHhhhCCCCCHHHHHHHHHHhCCChHHHHHHhhcchhHHHH
Q psy11996         10 TKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK   67 (222)
Q Consensus        10 ~~r~R~~~t~~q~~~L~~~f~~~~~p~~~~~~~la~~~~l~~~~v~~WF~nrR~k~~~   67 (222)
                      +||+|+.||.+|+.+|+..|..++||+..++++||..+||++.+|++||||||++++|
T Consensus         1 Grr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~vWFqNrR~k~kk   58 (58)
T d2craa1           1 GRKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKK   58 (58)
T ss_dssp             CCCSCCCSCHHHHHHHHHHHHHCSSCCHHHHHHHHHHTCCCHHHHHHHHHHHHHTTTS
T ss_pred             CCCCCCCCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCHHHeeecccchhhhccC
Confidence            4788999999999999999999999999999999999999999999999999998764



>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure