Psyllid ID: psy11996
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 222 | ||||||
| 344252749 | 222 | Homeobox protein Hox-A5 [Cricetulus gris | 0.734 | 0.734 | 0.572 | 1e-55 | |
| 270065291 | 302 | sex combs reduced [Oncopeltus fasciatus] | 0.486 | 0.357 | 0.882 | 3e-51 | |
| 224460203 | 338 | sex combs reduced [Rhodnius prolixus] | 0.486 | 0.319 | 0.864 | 5e-50 | |
| 47213840 | 369 | unnamed protein product [Tetraodon nigro | 0.828 | 0.498 | 0.539 | 1e-47 | |
| 383849607 | 373 | PREDICTED: homeobox protein Hox-A5a-like | 0.472 | 0.281 | 0.779 | 2e-44 | |
| 86515396 | 312 | cephalothorax [Tribolium castaneum] gi|1 | 0.472 | 0.336 | 0.779 | 3e-44 | |
| 7229537 | 312 | sex combs reduced Scr [Tribolium castane | 0.472 | 0.336 | 0.779 | 3e-44 | |
| 201023305 | 390 | sex combs reduced [Nasonia vitripennis] | 0.472 | 0.269 | 0.779 | 3e-44 | |
| 31205335 | 372 | AGAP004659-PA [Anopheles gambiae str. PE | 0.450 | 0.268 | 0.830 | 3e-44 | |
| 54607270 | 312 | cephalothorax [Tribolium castaneum] | 0.472 | 0.336 | 0.779 | 3e-44 |
| >gi|344252749|gb|EGW08853.1| Homeobox protein Hox-A5 [Cricetulus griseus] | Back alignment and taxonomy information |
|---|
Score = 221 bits (564), Expect = 1e-55, Method: Compositional matrix adjust.
Identities = 123/215 (57%), Positives = 139/215 (64%), Gaps = 52/215 (24%)
Query: 1 MSTVNANG-ETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQ 59
+S N G E KR RT+YTRYQTLELEKEFHFNRYLTRRRRIEIAHALCL+ERQIKIWFQ
Sbjct: 33 ISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQ 92
Query: 60 NRRMKWKKEHKMASMNNPNLYTQYQTQGKSCTGRYQVRPITSPHGAYHGDLRYHWTNRAP 119
NRRMKWKK++K+ SM NP +Y+G
Sbjct: 93 NRRMKWKKDNKLKSMINP---------------------------SYNG----------- 114
Query: 120 LKYVKRGTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIK 179
GE KR RT+YTR Q LELEKEFHFNRYLTRRRRIEIAH LCL+ERQ+K
Sbjct: 115 ------------GEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVK 162
Query: 180 IWFQNRRMKWKKEHKMASMNVIPYHYHMSQPYGNP 214
IWFQNRRMKWKK+HK+ + + + S P G P
Sbjct: 163 IWFQNRRMKWKKDHKLPNTKMRSSN-PASAPAGPP 196
|
Source: Cricetulus griseus Species: Cricetulus griseus Genus: Cricetulus Family: Cricetidae Order: Rodentia Class: Mammalia Phylum: Chordata Superkingdom: Eukaryota |
| >gi|270065291|gb|ACZ60640.1| sex combs reduced [Oncopeltus fasciatus] | Back alignment and taxonomy information |
|---|
| >gi|224460203|gb|ACN43631.1| sex combs reduced [Rhodnius prolixus] | Back alignment and taxonomy information |
|---|
| >gi|47213840|emb|CAG00644.1| unnamed protein product [Tetraodon nigroviridis] | Back alignment and taxonomy information |
|---|
| >gi|383849607|ref|XP_003700436.1| PREDICTED: homeobox protein Hox-A5a-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|86515396|ref|NP_001034523.1| cephalothorax [Tribolium castaneum] gi|13241681|gb|AAK16422.1|AF321227_2 Scr [Tribolium castaneum] gi|270002805|gb|EEZ99252.1| sex combs reduced [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|7229537|gb|AAF42868.1|AF227628_1 sex combs reduced Scr [Tribolium castaneum] gi|54607266|gb|AAL26542.2| cephalothorax [Tribolium castaneum] gi|54607268|gb|AAL27023.2| cephalothorax [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|201023305|ref|NP_001128396.1| sex combs reduced [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|31205335|ref|XP_311616.1| AGAP004659-PA [Anopheles gambiae str. PEST] gi|3420834|gb|AAC31944.1| Sex combs reduced homeotic protein [Anopheles gambiae] gi|30177656|gb|EAA07257.2| AGAP004659-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|54607270|gb|AAL23667.2| cephalothorax [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 222 | ||||||
| FB|FBgn0003339 | 417 | Scr "Sex combs reduced" [Droso | 0.450 | 0.239 | 0.813 | 6.7e-45 | |
| UNIPROTKB|F1NMG4 | 309 | LOC100858374 "Uncharacterized | 0.391 | 0.281 | 0.704 | 1e-29 | |
| UNIPROTKB|P17277 | 309 | HOXA4 "Homeobox protein Hox-A4 | 0.391 | 0.281 | 0.704 | 1e-29 | |
| UNIPROTKB|P14840 | 245 | HOXB4 "Homeobox protein Hox-B4 | 0.423 | 0.383 | 0.625 | 7.1e-29 | |
| UNIPROTKB|E2QT52 | 274 | HOXB4 "Uncharacterized protein | 0.427 | 0.346 | 0.625 | 9.1e-29 | |
| UNIPROTKB|F6UWC1 | 251 | HOXB4 "Uncharacterized protein | 0.427 | 0.378 | 0.625 | 9.1e-29 | |
| UNIPROTKB|F1RWG5 | 251 | HOXB4 "Uncharacterized protein | 0.427 | 0.378 | 0.625 | 9.1e-29 | |
| UNIPROTKB|F1N257 | 251 | HOXB4 "Homeobox protein Hox-B4 | 0.427 | 0.378 | 0.625 | 9.1e-29 | |
| UNIPROTKB|Q08DG5 | 251 | HOXB4 "Homeobox protein Hox-B4 | 0.427 | 0.378 | 0.625 | 9.1e-29 | |
| UNIPROTKB|P17483 | 251 | HOXB4 "Homeobox protein Hox-B4 | 0.427 | 0.378 | 0.625 | 9.1e-29 |
| FB|FBgn0003339 Scr "Sex combs reduced" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 446 (162.1 bits), Expect = 6.7e-45, Sum P(2) = 6.7e-45
Identities = 87/107 (81%), Positives = 92/107 (85%)
Query: 112 YHWTNRAPLKYVKRGTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHAL 171
Y W R ++ TVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHAL
Sbjct: 305 YPWMKRV---HLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHAL 361
Query: 172 CLTERQIKIWFQNRRMKWKKEHKMASMNVIPYHYHMSQPYGNPY-QF 217
CLTERQIKIWFQNRRMKWKKEHKMASMN++PYH M PYG+PY QF
Sbjct: 362 CLTERQIKIWFQNRRMKWKKEHKMASMNIVPYH--MG-PYGHPYHQF 405
|
|
| UNIPROTKB|F1NMG4 LOC100858374 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P17277 HOXA4 "Homeobox protein Hox-A4" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P14840 HOXB4 "Homeobox protein Hox-B4" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QT52 HOXB4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6UWC1 HOXB4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RWG5 HOXB4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N257 HOXB4 "Homeobox protein Hox-B4" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q08DG5 HOXB4 "Homeobox protein Hox-B4" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P17483 HOXB4 "Homeobox protein Hox-B4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 222 | |||
| pfam00046 | 57 | pfam00046, Homeobox, Homeobox domain | 5e-24 | |
| pfam00046 | 57 | pfam00046, Homeobox, Homeobox domain | 5e-24 | |
| smart00389 | 57 | smart00389, HOX, Homeodomain | 1e-19 | |
| smart00389 | 57 | smart00389, HOX, Homeodomain | 1e-19 | |
| cd00086 | 59 | cd00086, homeodomain, Homeodomain; DNA binding dom | 2e-19 | |
| cd00086 | 59 | cd00086, homeodomain, Homeodomain; DNA binding dom | 2e-19 | |
| COG5576 | 156 | COG5576, COG5576, Homeodomain-containing transcrip | 3e-07 | |
| COG5576 | 156 | COG5576, COG5576, Homeodomain-containing transcrip | 3e-07 |
| >gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain | Back alignment and domain information |
|---|
Score = 89.8 bits (224), Expect = 5e-24
Identities = 33/57 (57%), Positives = 42/57 (73%)
Query: 11 KRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK 67
+R+RT++T Q ELEKEF NRY + R E+A L LTERQ+K+WFQNRR KWK+
Sbjct: 1 RRKRTTFTPEQLEELEKEFEKNRYPSAEEREELAKKLGLTERQVKVWFQNRRAKWKR 57
|
Length = 57 |
| >gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain | Back alignment and domain information |
|---|
| >gnl|CDD|197696 smart00389, HOX, Homeodomain | Back alignment and domain information |
|---|
| >gnl|CDD|197696 smart00389, HOX, Homeodomain | Back alignment and domain information |
|---|
| >gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner | Back alignment and domain information |
|---|
| >gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner | Back alignment and domain information |
|---|
| >gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 222 | |||
| KOG0484|consensus | 125 | 99.81 | ||
| KOG0490|consensus | 235 | 99.8 | ||
| KOG0850|consensus | 245 | 99.73 | ||
| KOG0489|consensus | 261 | 99.72 | ||
| KOG2251|consensus | 228 | 99.71 | ||
| KOG0850|consensus | 245 | 99.7 | ||
| KOG0484|consensus | 125 | 99.69 | ||
| KOG0489|consensus | 261 | 99.69 | ||
| PF00046 | 57 | Homeobox: Homeobox domain not present here.; Inter | 99.69 | |
| KOG0842|consensus | 307 | 99.67 | ||
| KOG0843|consensus | 197 | 99.67 | ||
| PF00046 | 57 | Homeobox: Homeobox domain not present here.; Inter | 99.67 | |
| KOG0488|consensus | 309 | 99.66 | ||
| KOG0488|consensus | 309 | 99.66 | ||
| KOG0842|consensus | 307 | 99.66 | ||
| KOG0485|consensus | 268 | 99.65 | ||
| KOG0843|consensus | 197 | 99.65 | ||
| KOG0494|consensus | 332 | 99.64 | ||
| KOG2251|consensus | 228 | 99.63 | ||
| KOG0485|consensus | 268 | 99.6 | ||
| KOG0492|consensus | 246 | 99.59 | ||
| KOG0487|consensus | 308 | 99.57 | ||
| TIGR01565 | 58 | homeo_ZF_HD homeobox domain, ZF-HD class. This mod | 99.56 | |
| KOG0487|consensus | 308 | 99.56 | ||
| KOG0492|consensus | 246 | 99.56 | ||
| KOG0848|consensus | 317 | 99.56 | ||
| smart00389 | 56 | HOX Homeodomain. DNA-binding factors that are invo | 99.54 | |
| KOG0494|consensus | 332 | 99.54 | ||
| cd00086 | 59 | homeodomain Homeodomain; DNA binding domains invol | 99.54 | |
| smart00389 | 56 | HOX Homeodomain. DNA-binding factors that are invo | 99.53 | |
| cd00086 | 59 | homeodomain Homeodomain; DNA binding domains invol | 99.52 | |
| KOG0493|consensus | 342 | 99.52 | ||
| KOG0848|consensus | 317 | 99.51 | ||
| KOG0491|consensus | 194 | 99.5 | ||
| KOG0493|consensus | 342 | 99.49 | ||
| TIGR01565 | 58 | homeo_ZF_HD homeobox domain, ZF-HD class. This mod | 99.49 | |
| KOG3802|consensus | 398 | 99.48 | ||
| KOG0844|consensus | 408 | 99.45 | ||
| KOG0491|consensus | 194 | 99.45 | ||
| KOG0486|consensus | 351 | 99.45 | ||
| COG5576 | 156 | Homeodomain-containing transcription factor [Trans | 99.43 | |
| KOG3802|consensus | 398 | 99.42 | ||
| KOG4577|consensus | 383 | 99.42 | ||
| COG5576 | 156 | Homeodomain-containing transcription factor [Trans | 99.4 | |
| KOG0844|consensus | 408 | 99.39 | ||
| KOG0483|consensus | 198 | 99.37 | ||
| KOG0483|consensus | 198 | 99.35 | ||
| KOG4577|consensus | 383 | 99.35 | ||
| KOG0847|consensus | 288 | 99.33 | ||
| KOG0486|consensus | 351 | 99.31 | ||
| KOG0847|consensus | 288 | 99.3 | ||
| KOG1168|consensus | 385 | 99.02 | ||
| KOG0849|consensus | 354 | 99.02 | ||
| KOG0775|consensus | 304 | 98.96 | ||
| KOG0775|consensus | 304 | 98.96 | ||
| KOG1168|consensus | 385 | 98.95 | ||
| KOG0490|consensus | 235 | 98.93 | ||
| KOG0849|consensus | 354 | 98.84 | ||
| KOG0774|consensus | 334 | 98.78 | ||
| PF05920 | 40 | Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 | 98.74 | |
| PF05920 | 40 | Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 | 98.67 | |
| KOG0774|consensus | 334 | 98.51 | ||
| KOG1146|consensus | 1406 | 98.51 | ||
| KOG2252|consensus | 558 | 98.45 | ||
| KOG2252|consensus | 558 | 98.33 | ||
| KOG0773|consensus | 342 | 98.04 | ||
| KOG1146|consensus | 1406 | 98.0 | ||
| KOG3623|consensus | 1007 | 97.69 | ||
| PF11569 | 56 | Homez: Homeodomain leucine-zipper encoding, Homez; | 97.61 | |
| PF11569 | 56 | Homez: Homeodomain leucine-zipper encoding, Homez; | 97.53 | |
| KOG0773|consensus | 342 | 96.32 | ||
| KOG3623|consensus | 1007 | 96.13 | ||
| PF04218 | 53 | CENP-B_N: CENP-B N-terminal DNA-binding domain; In | 95.39 | |
| PF04218 | 53 | CENP-B_N: CENP-B N-terminal DNA-binding domain; In | 94.41 | |
| KOG3755|consensus | 769 | 92.12 | ||
| PF04545 | 50 | Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 | 87.79 | |
| PF04967 | 53 | HTH_10: HTH DNA binding domain; InterPro: IPR00705 | 85.78 | |
| PF01527 | 76 | HTH_Tnp_1: Transposase; InterPro: IPR002514 Transp | 84.03 | |
| PF04545 | 50 | Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 | 83.86 | |
| PF04967 | 53 | HTH_10: HTH DNA binding domain; InterPro: IPR00705 | 80.99 |
| >KOG0484|consensus | Back alignment and domain information |
|---|
Probab=99.81 E-value=4.9e-20 Score=125.75 Aligned_cols=70 Identities=37% Similarity=0.562 Sum_probs=64.9
Q ss_pred CCCCCCCCCCCCCCHHHHHHHHHHhhhCCCCCHHHHHHHHHHhCCChHHHHHHhhcchhHHHHHhhhhcc
Q psy11996 5 NANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKMASM 74 (222)
Q Consensus 5 ~~~~~~~r~R~~~t~~q~~~L~~~f~~~~~p~~~~~~~la~~~~l~~~~v~~WF~nrR~k~~~~~~~~~~ 74 (222)
...+++||-||+||..||..||..|.+.+||++..|++||.++.|++.+|++||||||+|.+++++....
T Consensus 12 ~ekrKQRRIRTTFTS~QLkELErvF~ETHYPDIYTREEiA~kidLTEARVQVWFQNRRAKfRKQEr~a~~ 81 (125)
T KOG0484|consen 12 TEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREEIALKIDLTEARVQVWFQNRRAKFRKQERAAIA 81 (125)
T ss_pred hHHHHhhhhhhhhhHHHHHHHHHHHHhhcCCcchhHHHHHHhhhhhHHHHHHHHHhhHHHHHHHHHHHHH
Confidence 3456789999999999999999999999999999999999999999999999999999999998876643
|
|
| >KOG0490|consensus | Back alignment and domain information |
|---|
| >KOG0850|consensus | Back alignment and domain information |
|---|
| >KOG0489|consensus | Back alignment and domain information |
|---|
| >KOG2251|consensus | Back alignment and domain information |
|---|
| >KOG0850|consensus | Back alignment and domain information |
|---|
| >KOG0484|consensus | Back alignment and domain information |
|---|
| >KOG0489|consensus | Back alignment and domain information |
|---|
| >PF00046 Homeobox: Homeobox domain not present here | Back alignment and domain information |
|---|
| >KOG0842|consensus | Back alignment and domain information |
|---|
| >KOG0843|consensus | Back alignment and domain information |
|---|
| >PF00046 Homeobox: Homeobox domain not present here | Back alignment and domain information |
|---|
| >KOG0488|consensus | Back alignment and domain information |
|---|
| >KOG0488|consensus | Back alignment and domain information |
|---|
| >KOG0842|consensus | Back alignment and domain information |
|---|
| >KOG0485|consensus | Back alignment and domain information |
|---|
| >KOG0843|consensus | Back alignment and domain information |
|---|
| >KOG0494|consensus | Back alignment and domain information |
|---|
| >KOG2251|consensus | Back alignment and domain information |
|---|
| >KOG0485|consensus | Back alignment and domain information |
|---|
| >KOG0492|consensus | Back alignment and domain information |
|---|
| >KOG0487|consensus | Back alignment and domain information |
|---|
| >TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class | Back alignment and domain information |
|---|
| >KOG0487|consensus | Back alignment and domain information |
|---|
| >KOG0492|consensus | Back alignment and domain information |
|---|
| >KOG0848|consensus | Back alignment and domain information |
|---|
| >smart00389 HOX Homeodomain | Back alignment and domain information |
|---|
| >KOG0494|consensus | Back alignment and domain information |
|---|
| >cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner | Back alignment and domain information |
|---|
| >smart00389 HOX Homeodomain | Back alignment and domain information |
|---|
| >cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner | Back alignment and domain information |
|---|
| >KOG0493|consensus | Back alignment and domain information |
|---|
| >KOG0848|consensus | Back alignment and domain information |
|---|
| >KOG0491|consensus | Back alignment and domain information |
|---|
| >KOG0493|consensus | Back alignment and domain information |
|---|
| >TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class | Back alignment and domain information |
|---|
| >KOG3802|consensus | Back alignment and domain information |
|---|
| >KOG0844|consensus | Back alignment and domain information |
|---|
| >KOG0491|consensus | Back alignment and domain information |
|---|
| >KOG0486|consensus | Back alignment and domain information |
|---|
| >COG5576 Homeodomain-containing transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG3802|consensus | Back alignment and domain information |
|---|
| >KOG4577|consensus | Back alignment and domain information |
|---|
| >COG5576 Homeodomain-containing transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0844|consensus | Back alignment and domain information |
|---|
| >KOG0483|consensus | Back alignment and domain information |
|---|
| >KOG0483|consensus | Back alignment and domain information |
|---|
| >KOG4577|consensus | Back alignment and domain information |
|---|
| >KOG0847|consensus | Back alignment and domain information |
|---|
| >KOG0486|consensus | Back alignment and domain information |
|---|
| >KOG0847|consensus | Back alignment and domain information |
|---|
| >KOG1168|consensus | Back alignment and domain information |
|---|
| >KOG0849|consensus | Back alignment and domain information |
|---|
| >KOG0775|consensus | Back alignment and domain information |
|---|
| >KOG0775|consensus | Back alignment and domain information |
|---|
| >KOG1168|consensus | Back alignment and domain information |
|---|
| >KOG0490|consensus | Back alignment and domain information |
|---|
| >KOG0849|consensus | Back alignment and domain information |
|---|
| >KOG0774|consensus | Back alignment and domain information |
|---|
| >PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] | Back alignment and domain information |
|---|
| >PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] | Back alignment and domain information |
|---|
| >KOG0774|consensus | Back alignment and domain information |
|---|
| >KOG1146|consensus | Back alignment and domain information |
|---|
| >KOG2252|consensus | Back alignment and domain information |
|---|
| >KOG2252|consensus | Back alignment and domain information |
|---|
| >KOG0773|consensus | Back alignment and domain information |
|---|
| >KOG1146|consensus | Back alignment and domain information |
|---|
| >KOG3623|consensus | Back alignment and domain information |
|---|
| >PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A | Back alignment and domain information |
|---|
| >PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A | Back alignment and domain information |
|---|
| >KOG0773|consensus | Back alignment and domain information |
|---|
| >KOG3623|consensus | Back alignment and domain information |
|---|
| >PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere | Back alignment and domain information |
|---|
| >PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere | Back alignment and domain information |
|---|
| >KOG3755|consensus | Back alignment and domain information |
|---|
| >PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription | Back alignment and domain information |
|---|
| >PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >PF01527 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition | Back alignment and domain information |
|---|
| >PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription | Back alignment and domain information |
|---|
| >PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 222 | ||||
| 2r5y_A | 88 | Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HO | 3e-33 | ||
| 2r5y_A | 88 | Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HO | 5e-33 | ||
| 1hom_A | 68 | Determination Of The Three-Dimensional Structure Of | 4e-26 | ||
| 1hom_A | 68 | Determination Of The Three-Dimensional Structure Of | 4e-26 | ||
| 1ahd_P | 68 | Determination Of The Nmr Solution Structure Of An A | 4e-25 | ||
| 1ahd_P | 68 | Determination Of The Nmr Solution Structure Of An A | 4e-25 | ||
| 9ant_A | 62 | Antennapedia Homeodomain-Dna Complex Length = 62 | 5e-25 | ||
| 9ant_A | 62 | Antennapedia Homeodomain-Dna Complex Length = 62 | 5e-25 | ||
| 1san_A | 62 | The Des(1-6)antennapedia Homeodomain: Comparison Of | 5e-24 | ||
| 1san_A | 62 | The Des(1-6)antennapedia Homeodomain: Comparison Of | 5e-24 | ||
| 1b8i_A | 81 | Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX | 6e-23 | ||
| 1b8i_A | 81 | Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX | 3e-22 | ||
| 1ftz_A | 70 | Nuclear Magnetic Resonance Solution Structure Of Th | 6e-23 | ||
| 1ftz_A | 70 | Nuclear Magnetic Resonance Solution Structure Of Th | 6e-23 | ||
| 2h1k_A | 63 | Crystal Structure Of The Pdx1 Homeodomain In Comple | 6e-19 | ||
| 2h1k_A | 63 | Crystal Structure Of The Pdx1 Homeodomain In Comple | 6e-19 | ||
| 2lp0_A | 60 | The Solution Structure Of Homeodomain-Protein Compl | 3e-17 | ||
| 2lp0_A | 60 | The Solution Structure Of Homeodomain-Protein Compl | 3e-17 | ||
| 1puf_A | 77 | Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bo | 1e-16 | ||
| 1puf_A | 77 | Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bo | 1e-16 | ||
| 2m34_A | 71 | Nmr Structure Of The Homeodomain Transcription Fact | 3e-15 | ||
| 2m34_A | 71 | Nmr Structure Of The Homeodomain Transcription Fact | 3e-15 | ||
| 1b72_A | 97 | Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Le | 5e-15 | ||
| 1b72_A | 97 | Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Le | 5e-15 | ||
| 3a01_A | 93 | Crystal Structure Of Aristaless And Clawless Homeod | 7e-11 | ||
| 3a01_A | 93 | Crystal Structure Of Aristaless And Clawless Homeod | 7e-11 | ||
| 2dmt_A | 80 | Solution Structure Of The Homeobox Domain Of Homeob | 8e-11 | ||
| 2cra_A | 70 | Solution Structure Of The Homeobox Domain Of Human | 2e-10 | ||
| 1hdd_C | 61 | Crystal Structure Of An Engrailed Homeodomain-Dna C | 3e-10 | ||
| 1hdd_C | 61 | Crystal Structure Of An Engrailed Homeodomain-Dna C | 3e-10 | ||
| 3hdd_A | 60 | Engrailed Homeodomain Dna Complex Length = 60 | 5e-10 | ||
| 3hdd_A | 60 | Engrailed Homeodomain Dna Complex Length = 60 | 5e-10 | ||
| 1ztr_A | 61 | Solution Structure Of Engrailed Homeodomain L16a Mu | 8e-10 | ||
| 1ztr_A | 61 | Solution Structure Of Engrailed Homeodomain L16a Mu | 8e-10 | ||
| 1p7j_A | 59 | Crystal Structure Of Engrailed Homeodomain Mutant K | 9e-10 | ||
| 1p7j_A | 59 | Crystal Structure Of Engrailed Homeodomain Mutant K | 9e-10 | ||
| 1p7i_A | 59 | Crystal Structure Of Engrailed Homeodomain Mutant K | 1e-09 | ||
| 1p7i_A | 59 | Crystal Structure Of Engrailed Homeodomain Mutant K | 1e-09 | ||
| 2hdd_A | 61 | Engrailed Homeodomain Q50k Variant Dna Complex Leng | 1e-09 | ||
| 2hdd_A | 61 | Engrailed Homeodomain Q50k Variant Dna Complex Leng | 1e-09 | ||
| 1jgg_A | 60 | Even-Skipped Homeodomain Complexed To At-Rich Dna L | 2e-09 | ||
| 1jgg_A | 60 | Even-Skipped Homeodomain Complexed To At-Rich Dna L | 2e-09 | ||
| 3a03_A | 56 | Crystal Structure Of Hox11l1 Homeodomain Length = 5 | 5e-09 | ||
| 3a03_A | 56 | Crystal Structure Of Hox11l1 Homeodomain Length = 5 | 5e-09 | ||
| 2l7z_A | 73 | Nmr Structure Of A13 Homedomain Length = 73 | 6e-09 | ||
| 2l7z_A | 73 | Nmr Structure Of A13 Homedomain Length = 73 | 6e-09 | ||
| 1du0_A | 57 | Engrailed Homeodomain Q50a Variant Dna Complex Leng | 6e-09 | ||
| 1du0_A | 57 | Engrailed Homeodomain Q50a Variant Dna Complex Leng | 6e-09 | ||
| 1enh_A | 54 | Structural Studies Of The Engrailed Homeodomain Len | 9e-09 | ||
| 1enh_A | 54 | Structural Studies Of The Engrailed Homeodomain Len | 9e-09 | ||
| 2ld5_A | 67 | Solution Nmr-Derived Complex Structure Of Hoxa13 Dn | 1e-08 | ||
| 2ld5_A | 67 | Solution Nmr-Derived Complex Structure Of Hoxa13 Dn | 1e-08 | ||
| 2djn_A | 70 | The Solution Structure Of The Homeobox Domain Of Hu | 1e-08 | ||
| 2e1o_A | 70 | Solution Structure Of Rsgi Ruh-028, A Homeobox Doma | 2e-08 | ||
| 2e1o_A | 70 | Solution Structure Of Rsgi Ruh-028, A Homeobox Doma | 2e-08 | ||
| 2hos_A | 63 | Phage-selected Homeodomain Bound To Unmodified Dna | 2e-08 | ||
| 2hos_A | 63 | Phage-selected Homeodomain Bound To Unmodified Dna | 2e-08 | ||
| 2m0c_A | 75 | Solution Nmr Structure Of Homeobox Domain Of Human | 3e-08 | ||
| 2m0c_A | 75 | Solution Nmr Structure Of Homeobox Domain Of Human | 4e-08 | ||
| 3a01_B | 67 | Crystal Structure Of Aristaless And Clawless Homeod | 6e-08 | ||
| 3a01_B | 67 | Crystal Structure Of Aristaless And Clawless Homeod | 6e-08 | ||
| 1ig7_A | 58 | Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 | 6e-08 | ||
| 1ig7_A | 58 | Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 | 6e-08 | ||
| 2l7f_P | 68 | Solution Structure Of The Pitx2 Homeodomain Length | 8e-08 | ||
| 2l7f_P | 68 | Solution Structure Of The Pitx2 Homeodomain Length | 8e-08 | ||
| 2cue_A | 80 | Solution Structure Of The Homeobox Domain Of The Hu | 1e-07 | ||
| 3lnq_A | 58 | Structure Of Aristaless Homeodomain In Complex With | 3e-07 | ||
| 3lnq_A | 58 | Structure Of Aristaless Homeodomain In Complex With | 3e-07 | ||
| 2p81_A | 44 | Engrailed Homeodomain Helix-Turn-Helix Motif Length | 4e-07 | ||
| 2p81_A | 44 | Engrailed Homeodomain Helix-Turn-Helix Motif Length | 4e-07 | ||
| 2l7m_P | 68 | Solution Structure Of The Pitx2 Homeodomain R24h Mu | 4e-07 | ||
| 2l7m_P | 68 | Solution Structure Of The Pitx2 Homeodomain R24h Mu | 4e-07 | ||
| 3a02_A | 60 | Crystal Structure Of Aristaless Homeodomain Length | 7e-07 | ||
| 3a02_A | 60 | Crystal Structure Of Aristaless Homeodomain Length | 7e-07 | ||
| 1zq3_P | 68 | Nmr Solution Structure Of The Bicoid Homeodomain Bo | 2e-06 | ||
| 1zq3_P | 68 | Nmr Solution Structure Of The Bicoid Homeodomain Bo | 2e-06 | ||
| 2l9r_A | 69 | Solution Nmr Structure Of Homeobox Domain Of Homeob | 3e-06 | ||
| 2l9r_A | 69 | Solution Nmr Structure Of Homeobox Domain Of Homeob | 3e-06 | ||
| 3rkq_A | 58 | Nkx2.5 Homeodomain Dimer Bound To Anf-242 Dna Lengt | 3e-06 | ||
| 3rkq_A | 58 | Nkx2.5 Homeodomain Dimer Bound To Anf-242 Dna Lengt | 3e-06 | ||
| 1nk2_P | 77 | VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES | 7e-06 | ||
| 1nk2_P | 77 | VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES | 7e-06 | ||
| 1fjl_A | 81 | Homeodomain From The Drosophila Paired Protein Boun | 1e-05 | ||
| 1fjl_A | 81 | Homeodomain From The Drosophila Paired Protein Boun | 1e-05 | ||
| 1qry_A | 80 | Homeobox Protein Vnd (Ventral Nervous System Defect | 1e-05 | ||
| 1qry_A | 80 | Homeobox Protein Vnd (Ventral Nervous System Defect | 2e-05 | ||
| 3cmy_A | 61 | Structure Of A Homeodomain In Complex With Dna Leng | 6e-05 | ||
| 3cmy_A | 61 | Structure Of A Homeodomain In Complex With Dna Leng | 6e-05 | ||
| 2vi6_A | 62 | Crystal Structure Of The Nanog Homeodomain Length = | 6e-05 | ||
| 2vi6_A | 62 | Crystal Structure Of The Nanog Homeodomain Length = | 6e-05 | ||
| 1ftt_A | 68 | Thyroid Transcription Factor 1 Homeodomain (Rattus | 8e-05 | ||
| 1ftt_A | 68 | Thyroid Transcription Factor 1 Homeodomain (Rattus | 8e-05 | ||
| 2dms_A | 80 | Solution Structure Of The Homeobox Domain Of Homeob | 9e-05 | ||
| 2dmu_A | 70 | Solution Structure Of The Homeobox Domain Of Homeob | 3e-04 | ||
| 2k40_A | 67 | Nmr Structure Of Hesx-1 Homeodomain Double Mutant R | 4e-04 | ||
| 2k40_A | 67 | Nmr Structure Of Hesx-1 Homeodomain Double Mutant R | 4e-04 | ||
| 2kt0_A | 84 | Solution Structure Of Human Stem Cell Transcription | 4e-04 | ||
| 2kt0_A | 84 | Solution Structure Of Human Stem Cell Transcription | 4e-04 |
| >pdb|2R5Y|A Chain A, Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HOX-Exd Site Length = 88 | Back alignment and structure |
|
| >pdb|2R5Y|A Chain A, Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HOX-Exd Site Length = 88 | Back alignment and structure |
| >pdb|1HOM|A Chain A, Determination Of The Three-Dimensional Structure Of The Antennapedia Homeodomain From Drosophila In Solution By 1h Nuclear Magnetic Resonance Spectroscopy Length = 68 | Back alignment and structure |
| >pdb|1HOM|A Chain A, Determination Of The Three-Dimensional Structure Of The Antennapedia Homeodomain From Drosophila In Solution By 1h Nuclear Magnetic Resonance Spectroscopy Length = 68 | Back alignment and structure |
| >pdb|1AHD|P Chain P, Determination Of The Nmr Solution Structure Of An Antennapedia Homeodomain-Dna Complex Length = 68 | Back alignment and structure |
| >pdb|1AHD|P Chain P, Determination Of The Nmr Solution Structure Of An Antennapedia Homeodomain-Dna Complex Length = 68 | Back alignment and structure |
| >pdb|9ANT|A Chain A, Antennapedia Homeodomain-Dna Complex Length = 62 | Back alignment and structure |
| >pdb|9ANT|A Chain A, Antennapedia Homeodomain-Dna Complex Length = 62 | Back alignment and structure |
| >pdb|1SAN|A Chain A, The Des(1-6)antennapedia Homeodomain: Comparison Of The Nmr Solution Structure And The Dna Binding Affinity With The Intact Antennapedia Homeodomain Length = 62 | Back alignment and structure |
| >pdb|1SAN|A Chain A, The Des(1-6)antennapedia Homeodomain: Comparison Of The Nmr Solution Structure And The Dna Binding Affinity With The Intact Antennapedia Homeodomain Length = 62 | Back alignment and structure |
| >pdb|1B8I|A Chain A, Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX Length = 81 | Back alignment and structure |
| >pdb|1B8I|A Chain A, Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX Length = 81 | Back alignment and structure |
| >pdb|1FTZ|A Chain A, Nuclear Magnetic Resonance Solution Structure Of The Fushi Tarazu Homeodomain From Drosophila And Comparison With The Antennapedia Homeodomain Length = 70 | Back alignment and structure |
| >pdb|1FTZ|A Chain A, Nuclear Magnetic Resonance Solution Structure Of The Fushi Tarazu Homeodomain From Drosophila And Comparison With The Antennapedia Homeodomain Length = 70 | Back alignment and structure |
| >pdb|2H1K|A Chain A, Crystal Structure Of The Pdx1 Homeodomain In Complex With Dna Length = 63 | Back alignment and structure |
| >pdb|2H1K|A Chain A, Crystal Structure Of The Pdx1 Homeodomain In Complex With Dna Length = 63 | Back alignment and structure |
| >pdb|2LP0|A Chain A, The Solution Structure Of Homeodomain-Protein Complex Length = 60 | Back alignment and structure |
| >pdb|2LP0|A Chain A, The Solution Structure Of Homeodomain-Protein Complex Length = 60 | Back alignment and structure |
| >pdb|1PUF|A Chain A, Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bound To Dna Length = 77 | Back alignment and structure |
| >pdb|1PUF|A Chain A, Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bound To Dna Length = 77 | Back alignment and structure |
| >pdb|2M34|A Chain A, Nmr Structure Of The Homeodomain Transcription Factor Gbx1 From Homo Sapiens Length = 71 | Back alignment and structure |
| >pdb|2M34|A Chain A, Nmr Structure Of The Homeodomain Transcription Factor Gbx1 From Homo Sapiens Length = 71 | Back alignment and structure |
| >pdb|1B72|A Chain A, Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Length = 97 | Back alignment and structure |
| >pdb|1B72|A Chain A, Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Length = 97 | Back alignment and structure |
| >pdb|3A01|A Chain A, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 93 | Back alignment and structure |
| >pdb|3A01|A Chain A, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 93 | Back alignment and structure |
| >pdb|2DMT|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Barh-Like 1 Length = 80 | Back alignment and structure |
| >pdb|2CRA|A Chain A, Solution Structure Of The Homeobox Domain Of Human Homeo Box B13 Length = 70 | Back alignment and structure |
| >pdb|1HDD|C Chain C, Crystal Structure Of An Engrailed Homeodomain-Dna Complex At 2.8 Angstroms Resolution: A Framework For Understanding Homeodomain-Dna Interactions Length = 61 | Back alignment and structure |
| >pdb|1HDD|C Chain C, Crystal Structure Of An Engrailed Homeodomain-Dna Complex At 2.8 Angstroms Resolution: A Framework For Understanding Homeodomain-Dna Interactions Length = 61 | Back alignment and structure |
| >pdb|3HDD|A Chain A, Engrailed Homeodomain Dna Complex Length = 60 | Back alignment and structure |
| >pdb|3HDD|A Chain A, Engrailed Homeodomain Dna Complex Length = 60 | Back alignment and structure |
| >pdb|1ZTR|A Chain A, Solution Structure Of Engrailed Homeodomain L16a Mutant Length = 61 | Back alignment and structure |
| >pdb|1ZTR|A Chain A, Solution Structure Of Engrailed Homeodomain L16a Mutant Length = 61 | Back alignment and structure |
| >pdb|1P7J|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52e Length = 59 | Back alignment and structure |
| >pdb|1P7J|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52e Length = 59 | Back alignment and structure |
| >pdb|1P7I|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52a Length = 59 | Back alignment and structure |
| >pdb|1P7I|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52a Length = 59 | Back alignment and structure |
| >pdb|2HDD|A Chain A, Engrailed Homeodomain Q50k Variant Dna Complex Length = 61 | Back alignment and structure |
| >pdb|2HDD|A Chain A, Engrailed Homeodomain Q50k Variant Dna Complex Length = 61 | Back alignment and structure |
| >pdb|1JGG|A Chain A, Even-Skipped Homeodomain Complexed To At-Rich Dna Length = 60 | Back alignment and structure |
| >pdb|1JGG|A Chain A, Even-Skipped Homeodomain Complexed To At-Rich Dna Length = 60 | Back alignment and structure |
| >pdb|3A03|A Chain A, Crystal Structure Of Hox11l1 Homeodomain Length = 56 | Back alignment and structure |
| >pdb|3A03|A Chain A, Crystal Structure Of Hox11l1 Homeodomain Length = 56 | Back alignment and structure |
| >pdb|2L7Z|A Chain A, Nmr Structure Of A13 Homedomain Length = 73 | Back alignment and structure |
| >pdb|2L7Z|A Chain A, Nmr Structure Of A13 Homedomain Length = 73 | Back alignment and structure |
| >pdb|1DU0|A Chain A, Engrailed Homeodomain Q50a Variant Dna Complex Length = 57 | Back alignment and structure |
| >pdb|1DU0|A Chain A, Engrailed Homeodomain Q50a Variant Dna Complex Length = 57 | Back alignment and structure |
| >pdb|1ENH|A Chain A, Structural Studies Of The Engrailed Homeodomain Length = 54 | Back alignment and structure |
| >pdb|1ENH|A Chain A, Structural Studies Of The Engrailed Homeodomain Length = 54 | Back alignment and structure |
| >pdb|2LD5|A Chain A, Solution Nmr-Derived Complex Structure Of Hoxa13 Dna Binding Domain Bound To Dna Length = 67 | Back alignment and structure |
| >pdb|2LD5|A Chain A, Solution Nmr-Derived Complex Structure Of Hoxa13 Dna Binding Domain Bound To Dna Length = 67 | Back alignment and structure |
| >pdb|2DJN|A Chain A, The Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Dlx-5 Length = 70 | Back alignment and structure |
| >pdb|2E1O|A Chain A, Solution Structure Of Rsgi Ruh-028, A Homeobox Domain From Human Cdna Length = 70 | Back alignment and structure |
| >pdb|2E1O|A Chain A, Solution Structure Of Rsgi Ruh-028, A Homeobox Domain From Human Cdna Length = 70 | Back alignment and structure |
| >pdb|2HOS|A Chain A, Phage-selected Homeodomain Bound To Unmodified Dna Length = 63 | Back alignment and structure |
| >pdb|2HOS|A Chain A, Phage-selected Homeodomain Bound To Unmodified Dna Length = 63 | Back alignment and structure |
| >pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 | Back alignment and structure |
| >pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 | Back alignment and structure |
| >pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 | Back alignment and structure |
| >pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 | Back alignment and structure |
| >pdb|1IG7|A Chain A, Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 | Back alignment and structure |
| >pdb|1IG7|A Chain A, Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 | Back alignment and structure |
| >pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 | Back alignment and structure |
| >pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 | Back alignment and structure |
| >pdb|2CUE|A Chain A, Solution Structure Of The Homeobox Domain Of The Human Paired Box Protein Pax-6 Length = 80 | Back alignment and structure |
| >pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 | Back alignment and structure |
| >pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 | Back alignment and structure |
| >pdb|2P81|A Chain A, Engrailed Homeodomain Helix-Turn-Helix Motif Length = 44 | Back alignment and structure |
| >pdb|2P81|A Chain A, Engrailed Homeodomain Helix-Turn-Helix Motif Length = 44 | Back alignment and structure |
| >pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 | Back alignment and structure |
| >pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 | Back alignment and structure |
| >pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 | Back alignment and structure |
| >pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 | Back alignment and structure |
| >pdb|1ZQ3|P Chain P, Nmr Solution Structure Of The Bicoid Homeodomain Bound To The Consensus Dna Binding Site Taatcc Length = 68 | Back alignment and structure |
| >pdb|1ZQ3|P Chain P, Nmr Solution Structure Of The Bicoid Homeodomain Bound To The Consensus Dna Binding Site Taatcc Length = 68 | Back alignment and structure |
| >pdb|2L9R|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Homeobox Protein Nkx-3.1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr6470a Length = 69 | Back alignment and structure |
| >pdb|2L9R|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Homeobox Protein Nkx-3.1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr6470a Length = 69 | Back alignment and structure |
| >pdb|3RKQ|A Chain A, Nkx2.5 Homeodomain Dimer Bound To Anf-242 Dna Length = 58 | Back alignment and structure |
| >pdb|3RKQ|A Chain A, Nkx2.5 Homeodomain Dimer Bound To Anf-242 Dna Length = 58 | Back alignment and structure |
| >pdb|1NK2|P Chain P, VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES Length = 77 | Back alignment and structure |
| >pdb|1NK2|P Chain P, VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES Length = 77 | Back alignment and structure |
| >pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 | Back alignment and structure |
| >pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 | Back alignment and structure |
| >pdb|1QRY|A Chain A, Homeobox Protein Vnd (Ventral Nervous System Defective Protein) Length = 80 | Back alignment and structure |
| >pdb|1QRY|A Chain A, Homeobox Protein Vnd (Ventral Nervous System Defective Protein) Length = 80 | Back alignment and structure |
| >pdb|3CMY|A Chain A, Structure Of A Homeodomain In Complex With Dna Length = 61 | Back alignment and structure |
| >pdb|3CMY|A Chain A, Structure Of A Homeodomain In Complex With Dna Length = 61 | Back alignment and structure |
| >pdb|2VI6|A Chain A, Crystal Structure Of The Nanog Homeodomain Length = 62 | Back alignment and structure |
| >pdb|2VI6|A Chain A, Crystal Structure Of The Nanog Homeodomain Length = 62 | Back alignment and structure |
| >pdb|1FTT|A Chain A, Thyroid Transcription Factor 1 Homeodomain (Rattus Norvegicus) Length = 68 | Back alignment and structure |
| >pdb|1FTT|A Chain A, Thyroid Transcription Factor 1 Homeodomain (Rattus Norvegicus) Length = 68 | Back alignment and structure |
| >pdb|2DMS|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Otx2 Length = 80 | Back alignment and structure |
| >pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 | Back alignment and structure |
| >pdb|2K40|A Chain A, Nmr Structure Of Hesx-1 Homeodomain Double Mutant R31lE42L Length = 67 | Back alignment and structure |
| >pdb|2K40|A Chain A, Nmr Structure Of Hesx-1 Homeodomain Double Mutant R31lE42L Length = 67 | Back alignment and structure |
| >pdb|2KT0|A Chain A, Solution Structure Of Human Stem Cell Transcription Factor Nanog Homeodomain Fragment Length = 84 | Back alignment and structure |
| >pdb|2KT0|A Chain A, Solution Structure Of Human Stem Cell Transcription Factor Nanog Homeodomain Fragment Length = 84 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 222 | |||
| 1b8i_A | 81 | Ultrabithorax, protein (ultrabithorax homeotic pro | 9e-40 | |
| 1b8i_A | 81 | Ultrabithorax, protein (ultrabithorax homeotic pro | 2e-38 | |
| 2r5y_A | 88 | Homeotic protein sex combs reduced; homeodomain; H | 5e-39 | |
| 2r5y_A | 88 | Homeotic protein sex combs reduced; homeodomain; H | 6e-39 | |
| 1b72_A | 97 | Protein (homeobox protein HOX-B1); homeodomain, DN | 2e-38 | |
| 1b72_A | 97 | Protein (homeobox protein HOX-B1); homeodomain, DN | 2e-38 | |
| 2h1k_A | 63 | IPF-1, pancreatic and duodenal homeobox 1, homeodo | 7e-36 | |
| 2h1k_A | 63 | IPF-1, pancreatic and duodenal homeobox 1, homeodo | 7e-36 | |
| 1ahd_P | 68 | Antennapedia protein mutant; DNA binding protein/D | 1e-35 | |
| 1ahd_P | 68 | Antennapedia protein mutant; DNA binding protein/D | 1e-35 | |
| 2e1o_A | 70 | Homeobox protein PRH; DNA binding protein, structu | 4e-35 | |
| 2e1o_A | 70 | Homeobox protein PRH; DNA binding protein, structu | 4e-35 | |
| 2dmt_A | 80 | Homeobox protein BARH-like 1; homeobox domain, thr | 1e-34 | |
| 2dmt_A | 80 | Homeobox protein BARH-like 1; homeobox domain, thr | 1e-34 | |
| 1zq3_P | 68 | PRD-4, homeotic bicoid protein; protein-DNA comple | 4e-34 | |
| 1zq3_P | 68 | PRD-4, homeotic bicoid protein; protein-DNA comple | 4e-34 | |
| 1puf_A | 77 | HOX-1.7, homeobox protein HOX-A9; homeodomian, pro | 4e-34 | |
| 1puf_A | 77 | HOX-1.7, homeobox protein HOX-A9; homeodomian, pro | 4e-34 | |
| 2hdd_A | 61 | Protein (engrailed homeodomain Q50K); DNA binding, | 7e-34 | |
| 2hdd_A | 61 | Protein (engrailed homeodomain Q50K); DNA binding, | 7e-34 | |
| 2cra_A | 70 | Homeobox protein HOX-B13; DNA-binding, transcripti | 1e-33 | |
| 2cra_A | 70 | Homeobox protein HOX-B13; DNA-binding, transcripti | 1e-33 | |
| 1jgg_A | 60 | Segmentation protein EVEN-skipped; homeodomain, pr | 5e-33 | |
| 1jgg_A | 60 | Segmentation protein EVEN-skipped; homeodomain, pr | 5e-33 | |
| 2l7z_A | 73 | Homeobox protein HOX-A13; gene regulation; NMR {Ho | 7e-32 | |
| 2l7z_A | 73 | Homeobox protein HOX-A13; gene regulation; NMR {Ho | 7e-32 | |
| 3a01_A | 93 | Homeodomain-containing protein; homeodomain, prote | 3e-31 | |
| 3a01_A | 93 | Homeodomain-containing protein; homeodomain, prote | 3e-31 | |
| 2djn_A | 70 | Homeobox protein DLX-5; structural genomics, NPPSF | 3e-29 | |
| 2djn_A | 70 | Homeobox protein DLX-5; structural genomics, NPPSF | 3e-29 | |
| 2l9r_A | 69 | Homeobox protein NKX-3.1; structural genomics, nor | 2e-28 | |
| 2l9r_A | 69 | Homeobox protein NKX-3.1; structural genomics, nor | 2e-28 | |
| 1akh_A | 61 | Protein (mating-type protein A-1); complex (TWO DN | 8e-27 | |
| 1akh_A | 61 | Protein (mating-type protein A-1); complex (TWO DN | 8e-27 | |
| 2kt0_A | 84 | Nanog, homeobox protein nanog; homeodomain, struct | 2e-26 | |
| 2kt0_A | 84 | Nanog, homeobox protein nanog; homeodomain, struct | 2e-26 | |
| 1ig7_A | 58 | Homeotic protein MSX-1; helix-turn-helix, transcri | 4e-26 | |
| 1ig7_A | 58 | Homeotic protein MSX-1; helix-turn-helix, transcri | 4e-26 | |
| 2vi6_A | 62 | Homeobox protein nanog; homeodomain, DNA-binding, | 7e-26 | |
| 2vi6_A | 62 | Homeobox protein nanog; homeodomain, DNA-binding, | 7e-26 | |
| 1nk2_P | 77 | Homeobox protein VND; homeodomain, DNA-binding pro | 1e-25 | |
| 1nk2_P | 77 | Homeobox protein VND; homeodomain, DNA-binding pro | 3e-25 | |
| 3a03_A | 56 | T-cell leukemia homeobox protein 2; homeodomain, d | 8e-24 | |
| 3a03_A | 56 | T-cell leukemia homeobox protein 2; homeodomain, d | 8e-24 | |
| 3rkq_A | 58 | Homeobox protein NKX-2.5; helix-turn-helix, DNA bi | 4e-23 | |
| 3rkq_A | 58 | Homeobox protein NKX-2.5; helix-turn-helix, DNA bi | 4e-23 | |
| 1ftt_A | 68 | TTF-1 HD, thyroid transcription factor 1 homeodoma | 3e-22 | |
| 1ftt_A | 68 | TTF-1 HD, thyroid transcription factor 1 homeodoma | 3e-22 | |
| 1e3o_C | 160 | Octamer-binding transcription factor 1; transcript | 4e-22 | |
| 1e3o_C | 160 | Octamer-binding transcription factor 1; transcript | 4e-22 | |
| 2xsd_C | 164 | POU domain, class 3, transcription factor 1; trans | 4e-19 | |
| 2xsd_C | 164 | POU domain, class 3, transcription factor 1; trans | 4e-19 | |
| 1au7_A | 146 | Protein PIT-1, GHF-1; complex (DNA-binding protein | 1e-17 | |
| 1au7_A | 146 | Protein PIT-1, GHF-1; complex (DNA-binding protein | 1e-17 | |
| 2dn0_A | 76 | Zinc fingers and homeoboxes protein 3; triple home | 1e-16 | |
| 2dn0_A | 76 | Zinc fingers and homeoboxes protein 3; triple home | 1e-16 | |
| 2da3_A | 80 | Alpha-fetoprotein enhancer binding protein; homeob | 2e-16 | |
| 2da3_A | 80 | Alpha-fetoprotein enhancer binding protein; homeob | 2e-16 | |
| 2da2_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 2e-16 | |
| 2da2_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 2e-16 | |
| 2da1_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 3e-15 | |
| 2da1_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 3e-15 | |
| 2hi3_A | 73 | Homeodomain-only protein; transcription; NMR {Mus | 8e-15 | |
| 2hi3_A | 73 | Homeodomain-only protein; transcription; NMR {Mus | 8e-15 | |
| 3l1p_A | 155 | POU domain, class 5, transcription factor 1; POU, | 8e-15 | |
| 3l1p_A | 155 | POU domain, class 5, transcription factor 1; POU, | 8e-15 | |
| 3d1n_I | 151 | POU domain, class 6, transcription factor 1; prote | 2e-14 | |
| 3d1n_I | 151 | POU domain, class 6, transcription factor 1; prote | 2e-14 | |
| 2k40_A | 67 | Homeobox expressed in ES cells 1; thermostable hom | 1e-13 | |
| 2k40_A | 67 | Homeobox expressed in ES cells 1; thermostable hom | 1e-13 | |
| 2dms_A | 80 | Homeobox protein OTX2; homeobox domain, three heli | 1e-13 | |
| 2dms_A | 80 | Homeobox protein OTX2; homeobox domain, three heli | 3e-13 | |
| 2dmq_A | 80 | LIM/homeobox protein LHX9; homeobox domain, three | 2e-13 | |
| 2dmq_A | 80 | LIM/homeobox protein LHX9; homeobox domain, three | 3e-13 | |
| 1fjl_A | 81 | Paired protein; DNA-binding protein, paired BOX, t | 2e-13 | |
| 1fjl_A | 81 | Paired protein; DNA-binding protein, paired BOX, t | 2e-13 | |
| 1yz8_P | 68 | Pituitary homeobox 2; DNA binding protein, transcr | 4e-13 | |
| 1yz8_P | 68 | Pituitary homeobox 2; DNA binding protein, transcr | 4e-13 | |
| 3a02_A | 60 | Homeobox protein aristaless; homeodomain, developm | 7e-13 | |
| 3a02_A | 60 | Homeobox protein aristaless; homeodomain, developm | 7e-13 | |
| 2cue_A | 80 | Paired box protein PAX6; homeobox domain, transcri | 1e-12 | |
| 2cue_A | 80 | Paired box protein PAX6; homeobox domain, transcri | 2e-12 | |
| 1bw5_A | 66 | ISL-1HD, insulin gene enhancer protein ISL-1; DNA- | 1e-12 | |
| 1bw5_A | 66 | ISL-1HD, insulin gene enhancer protein ISL-1; DNA- | 1e-12 | |
| 1wi3_A | 71 | DNA-binding protein SATB2; homeodomain, helix-turn | 2e-12 | |
| 1wi3_A | 71 | DNA-binding protein SATB2; homeodomain, helix-turn | 2e-12 | |
| 2dmu_A | 70 | Homeobox protein goosecoid; homeobox domain, three | 3e-12 | |
| 2dmu_A | 70 | Homeobox protein goosecoid; homeobox domain, three | 3e-12 | |
| 2cuf_A | 95 | FLJ21616 protein; homeobox domain, hepatocyte tran | 1e-11 | |
| 2cuf_A | 95 | FLJ21616 protein; homeobox domain, hepatocyte tran | 1e-11 | |
| 2ecb_A | 89 | Zinc fingers and homeoboxes protein 1; homeobox do | 4e-11 | |
| 2ecb_A | 89 | Zinc fingers and homeoboxes protein 1; homeobox do | 7e-11 | |
| 2dmp_A | 89 | Zinc fingers and homeoboxes protein 2; homeobox do | 4e-11 | |
| 2dmp_A | 89 | Zinc fingers and homeoboxes protein 2; homeobox do | 4e-11 | |
| 1uhs_A | 72 | HOP, homeodomain only protein; structural genomics | 8e-11 | |
| 1uhs_A | 72 | HOP, homeodomain only protein; structural genomics | 8e-11 | |
| 2da5_A | 75 | Zinc fingers and homeoboxes protein 3; homeobox do | 2e-10 | |
| 2da5_A | 75 | Zinc fingers and homeoboxes protein 3; homeobox do | 2e-10 | |
| 3nau_A | 66 | Zinc fingers and homeoboxes protein 2; ZHX2, corep | 2e-10 | |
| 3nau_A | 66 | Zinc fingers and homeoboxes protein 2; ZHX2, corep | 2e-10 | |
| 2d5v_A | 164 | Hepatocyte nuclear factor 6; transcription factor, | 7e-10 | |
| 2d5v_A | 164 | Hepatocyte nuclear factor 6; transcription factor, | 1e-09 | |
| 2cqx_A | 72 | LAG1 longevity assurance homolog 5; homeodomain, D | 7e-08 | |
| 2cqx_A | 72 | LAG1 longevity assurance homolog 5; homeodomain, D | 7e-08 | |
| 1lfb_A | 99 | Liver transcription factor (LFB1); transcription r | 2e-06 | |
| 1lfb_A | 99 | Liver transcription factor (LFB1); transcription r | 3e-06 | |
| 1x2m_A | 64 | LAG1 longevity assurance homolog 6; homeobox domai | 6e-06 | |
| 1x2m_A | 64 | LAG1 longevity assurance homolog 6; homeobox domai | 6e-06 | |
| 2h8r_A | 221 | Hepatocyte nuclear factor 1-beta; trasncription fa | 1e-05 | |
| 2h8r_A | 221 | Hepatocyte nuclear factor 1-beta; trasncription fa | 5e-05 | |
| 3nar_A | 96 | ZHX1, zinc fingers and homeoboxes protein 1; corep | 7e-05 | |
| 3nar_A | 96 | ZHX1, zinc fingers and homeoboxes protein 1; corep | 7e-05 | |
| 1ic8_A | 194 | Hepatocyte nuclear factor 1-alpha; transcription r | 1e-04 | |
| 1ic8_A | 194 | Hepatocyte nuclear factor 1-alpha; transcription r | 1e-04 |
| >1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 | Back alignment and structure |
|---|
Score = 130 bits (329), Expect = 9e-40
Identities = 52/70 (74%), Positives = 57/70 (81%)
Query: 1 MSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQN 60
M+ NG +R R +YTRYQTLELEKEFH N YLTRRRRIE+AHAL LTERQIKIWFQN
Sbjct: 11 MAIAGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALSLTERQIKIWFQN 70
Query: 61 RRMKWKKEHK 70
RRMK KKE +
Sbjct: 71 RRMKLKKEIQ 80
|
| >1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 | Back alignment and structure |
|---|
| >2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 | Back alignment and structure |
|---|
| >2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 | Back alignment and structure |
|---|
| >1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 | Back alignment and structure |
|---|
| >1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 | Back alignment and structure |
|---|
| >2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 | Back alignment and structure |
|---|
| >2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 | Back alignment and structure |
|---|
| >1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 | Back alignment and structure |
|---|
| >1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 | Back alignment and structure |
|---|
| >2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 | Back alignment and structure |
|---|
| >2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 | Back alignment and structure |
|---|
| >2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 | Back alignment and structure |
|---|
| >1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 | Back alignment and structure |
|---|
| >1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 | Back alignment and structure |
|---|
| >1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 | Back alignment and structure |
|---|
| >2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 | Back alignment and structure |
|---|
| >2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 | Back alignment and structure |
|---|
| >2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 | Back alignment and structure |
|---|
| >2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 | Back alignment and structure |
|---|
| >1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 | Back alignment and structure |
|---|
| >1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 | Back alignment and structure |
|---|
| >2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 | Back alignment and structure |
|---|
| >2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 | Back alignment and structure |
|---|
| >3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 | Back alignment and structure |
|---|
| >3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 | Back alignment and structure |
|---|
| >2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 | Back alignment and structure |
|---|
| >1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 | Back alignment and structure |
|---|
| >2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 | Back alignment and structure |
|---|
| >2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 | Back alignment and structure |
|---|
| >1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 | Back alignment and structure |
|---|
| >1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 | Back alignment and structure |
|---|
| >2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 | Back alignment and structure |
|---|
| >2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 | Back alignment and structure |
|---|
| >1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 | Back alignment and structure |
|---|
| >1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 | Back alignment and structure |
|---|
| >3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 | Back alignment and structure |
|---|
| >3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 | Back alignment and structure |
|---|
| >3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 | Back alignment and structure |
|---|
| >1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 | Back alignment and structure |
|---|
| >1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 | Back alignment and structure |
|---|
| >1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 | Back alignment and structure |
|---|
| >2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 | Back alignment and structure |
|---|
| >1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 | Back alignment and structure |
|---|
| >2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 | Back alignment and structure |
|---|
| >2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 | Back alignment and structure |
|---|
| >3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 | Back alignment and structure |
|---|
| >3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 | Back alignment and structure |
|---|
| >3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 | Back alignment and structure |
|---|
| >2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 | Back alignment and structure |
|---|
| >2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 | Back alignment and structure |
|---|
| >1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 | Back alignment and structure |
|---|
| >1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 | Back alignment and structure |
|---|
| >1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 | Back alignment and structure |
|---|
| >3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 | Back alignment and structure |
|---|
| >3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 | Back alignment and structure |
|---|
| >2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 | Back alignment and structure |
|---|
| >2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 | Back alignment and structure |
|---|
| >1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 | Back alignment and structure |
|---|
| >1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 | Back alignment and structure |
|---|
| >1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 | Back alignment and structure |
|---|
| >1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 | Back alignment and structure |
|---|
| >2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 | Back alignment and structure |
|---|
| >2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 | Back alignment and structure |
|---|
| >2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 | Back alignment and structure |
|---|
| >2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 | Back alignment and structure |
|---|
| >2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 | Back alignment and structure |
|---|
| >1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 | Back alignment and structure |
|---|
| >2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 | Back alignment and structure |
|---|
| >2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 | Back alignment and structure |
|---|
| >2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 | Back alignment and structure |
|---|
| >2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 | Back alignment and structure |
|---|
| >1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 | Back alignment and structure |
|---|
| >1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 | Back alignment and structure |
|---|
| >1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 | Back alignment and structure |
|---|
| >1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 | Back alignment and structure |
|---|
| >2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 | Back alignment and structure |
|---|
| >2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 | Back alignment and structure |
|---|
| >3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 | Back alignment and structure |
|---|
| >1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 222 | |||
| 2dmu_A | 70 | Homeobox protein goosecoid; homeobox domain, three | 99.81 | |
| 1nk2_P | 77 | Homeobox protein VND; homeodomain, DNA-binding pro | 99.81 | |
| 2dms_A | 80 | Homeobox protein OTX2; homeobox domain, three heli | 99.81 | |
| 2r5y_A | 88 | Homeotic protein sex combs reduced; homeodomain; H | 99.8 | |
| 2cra_A | 70 | Homeobox protein HOX-B13; DNA-binding, transcripti | 99.8 | |
| 2cue_A | 80 | Paired box protein PAX6; homeobox domain, transcri | 99.8 | |
| 2dmq_A | 80 | LIM/homeobox protein LHX9; homeobox domain, three | 99.8 | |
| 1b72_A | 97 | Protein (homeobox protein HOX-B1); homeodomain, DN | 99.8 | |
| 2e1o_A | 70 | Homeobox protein PRH; DNA binding protein, structu | 99.8 | |
| 2h1k_A | 63 | IPF-1, pancreatic and duodenal homeobox 1, homeodo | 99.8 | |
| 1nk2_P | 77 | Homeobox protein VND; homeodomain, DNA-binding pro | 99.8 | |
| 2da1_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 99.79 | |
| 1puf_A | 77 | HOX-1.7, homeobox protein HOX-A9; homeodomian, pro | 99.79 | |
| 2da2_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 99.79 | |
| 2dmt_A | 80 | Homeobox protein BARH-like 1; homeobox domain, thr | 99.79 | |
| 2m0c_A | 75 | Homeobox protein aristaless-like 4; structural gen | 99.79 | |
| 2djn_A | 70 | Homeobox protein DLX-5; structural genomics, NPPSF | 99.79 | |
| 2hdd_A | 61 | Protein (engrailed homeodomain Q50K); DNA binding, | 99.79 | |
| 1ig7_A | 58 | Homeotic protein MSX-1; helix-turn-helix, transcri | 99.79 | |
| 2dmu_A | 70 | Homeobox protein goosecoid; homeobox domain, three | 99.79 | |
| 1zq3_P | 68 | PRD-4, homeotic bicoid protein; protein-DNA comple | 99.79 | |
| 2dmt_A | 80 | Homeobox protein BARH-like 1; homeobox domain, thr | 99.78 | |
| 1b8i_A | 81 | Ultrabithorax, protein (ultrabithorax homeotic pro | 99.78 | |
| 2vi6_A | 62 | Homeobox protein nanog; homeodomain, DNA-binding, | 99.78 | |
| 2cra_A | 70 | Homeobox protein HOX-B13; DNA-binding, transcripti | 99.78 | |
| 2dms_A | 80 | Homeobox protein OTX2; homeobox domain, three heli | 99.78 | |
| 2h1k_A | 63 | IPF-1, pancreatic and duodenal homeobox 1, homeodo | 99.78 | |
| 2da3_A | 80 | Alpha-fetoprotein enhancer binding protein; homeob | 99.78 | |
| 1wh5_A | 80 | ZF-HD homeobox family protein; structural genomics | 99.78 | |
| 2dmq_A | 80 | LIM/homeobox protein LHX9; homeobox domain, three | 99.78 | |
| 2da2_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 99.78 | |
| 2kt0_A | 84 | Nanog, homeobox protein nanog; homeodomain, struct | 99.78 | |
| 2e1o_A | 70 | Homeobox protein PRH; DNA binding protein, structu | 99.78 | |
| 1ftt_A | 68 | TTF-1 HD, thyroid transcription factor 1 homeodoma | 99.78 | |
| 1ahd_P | 68 | Antennapedia protein mutant; DNA binding protein/D | 99.78 | |
| 1yz8_P | 68 | Pituitary homeobox 2; DNA binding protein, transcr | 99.78 | |
| 1jgg_A | 60 | Segmentation protein EVEN-skipped; homeodomain, pr | 99.78 | |
| 2kt0_A | 84 | Nanog, homeobox protein nanog; homeodomain, struct | 99.78 | |
| 2m0c_A | 75 | Homeobox protein aristaless-like 4; structural gen | 99.78 | |
| 2r5y_A | 88 | Homeotic protein sex combs reduced; homeodomain; H | 99.77 | |
| 2cue_A | 80 | Paired box protein PAX6; homeobox domain, transcri | 99.77 | |
| 2vi6_A | 62 | Homeobox protein nanog; homeodomain, DNA-binding, | 99.77 | |
| 2djn_A | 70 | Homeobox protein DLX-5; structural genomics, NPPSF | 99.77 | |
| 1fjl_A | 81 | Paired protein; DNA-binding protein, paired BOX, t | 99.77 | |
| 2l7z_A | 73 | Homeobox protein HOX-A13; gene regulation; NMR {Ho | 99.77 | |
| 2da4_A | 80 | Hypothetical protein DKFZP686K21156; homeobox doma | 99.77 | |
| 2da1_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 99.77 | |
| 1yz8_P | 68 | Pituitary homeobox 2; DNA binding protein, transcr | 99.77 | |
| 2da3_A | 80 | Alpha-fetoprotein enhancer binding protein; homeob | 99.77 | |
| 2ecc_A | 76 | Homeobox and leucine zipper protein homez; homeobo | 99.77 | |
| 1ig7_A | 58 | Homeotic protein MSX-1; helix-turn-helix, transcri | 99.77 | |
| 1bw5_A | 66 | ISL-1HD, insulin gene enhancer protein ISL-1; DNA- | 99.77 | |
| 1ftt_A | 68 | TTF-1 HD, thyroid transcription factor 1 homeodoma | 99.76 | |
| 2hdd_A | 61 | Protein (engrailed homeodomain Q50K); DNA binding, | 99.76 | |
| 1puf_A | 77 | HOX-1.7, homeobox protein HOX-A9; homeodomian, pro | 99.76 | |
| 3a01_A | 93 | Homeodomain-containing protein; homeodomain, prote | 99.76 | |
| 1uhs_A | 72 | HOP, homeodomain only protein; structural genomics | 99.76 | |
| 1ahd_P | 68 | Antennapedia protein mutant; DNA binding protein/D | 99.76 | |
| 3rkq_A | 58 | Homeobox protein NKX-2.5; helix-turn-helix, DNA bi | 99.76 | |
| 2k40_A | 67 | Homeobox expressed in ES cells 1; thermostable hom | 99.76 | |
| 1wh7_A | 80 | ZF-HD homeobox family protein; homeobox domain, st | 99.76 | |
| 2ecc_A | 76 | Homeobox and leucine zipper protein homez; homeobo | 99.76 | |
| 1jgg_A | 60 | Segmentation protein EVEN-skipped; homeodomain, pr | 99.76 | |
| 3a02_A | 60 | Homeobox protein aristaless; homeodomain, developm | 99.76 | |
| 1akh_A | 61 | Protein (mating-type protein A-1); complex (TWO DN | 99.76 | |
| 2hi3_A | 73 | Homeodomain-only protein; transcription; NMR {Mus | 99.75 | |
| 1b72_A | 97 | Protein (homeobox protein HOX-B1); homeodomain, DN | 99.75 | |
| 3a02_A | 60 | Homeobox protein aristaless; homeodomain, developm | 99.75 | |
| 1zq3_P | 68 | PRD-4, homeotic bicoid protein; protein-DNA comple | 99.75 | |
| 2cuf_A | 95 | FLJ21616 protein; homeobox domain, hepatocyte tran | 99.75 | |
| 2da5_A | 75 | Zinc fingers and homeoboxes protein 3; homeobox do | 99.75 | |
| 1fjl_A | 81 | Paired protein; DNA-binding protein, paired BOX, t | 99.75 | |
| 1b8i_A | 81 | Ultrabithorax, protein (ultrabithorax homeotic pro | 99.75 | |
| 1uhs_A | 72 | HOP, homeodomain only protein; structural genomics | 99.75 | |
| 1wi3_A | 71 | DNA-binding protein SATB2; homeodomain, helix-turn | 99.75 | |
| 3a01_A | 93 | Homeodomain-containing protein; homeodomain, prote | 99.75 | |
| 2dn0_A | 76 | Zinc fingers and homeoboxes protein 3; triple home | 99.75 | |
| 2k40_A | 67 | Homeobox expressed in ES cells 1; thermostable hom | 99.75 | |
| 2hi3_A | 73 | Homeodomain-only protein; transcription; NMR {Mus | 99.75 | |
| 1wh5_A | 80 | ZF-HD homeobox family protein; structural genomics | 99.75 | |
| 1bw5_A | 66 | ISL-1HD, insulin gene enhancer protein ISL-1; DNA- | 99.75 | |
| 2l7z_A | 73 | Homeobox protein HOX-A13; gene regulation; NMR {Ho | 99.75 | |
| 1x2n_A | 73 | Homeobox protein pknox1; homeobox domain, structur | 99.74 | |
| 3a03_A | 56 | T-cell leukemia homeobox protein 2; homeodomain, d | 99.74 | |
| 2ecb_A | 89 | Zinc fingers and homeoboxes protein 1; homeobox do | 99.74 | |
| 2ecb_A | 89 | Zinc fingers and homeoboxes protein 1; homeobox do | 99.74 | |
| 3a03_A | 56 | T-cell leukemia homeobox protein 2; homeodomain, d | 99.74 | |
| 2dmn_A | 83 | Homeobox protein TGIF2LX; TGFB-induced factor 2-li | 99.74 | |
| 2ly9_A | 74 | Zinc fingers and homeoboxes protein 1; structural | 99.74 | |
| 2ly9_A | 74 | Zinc fingers and homeoboxes protein 1; structural | 99.74 | |
| 2da4_A | 80 | Hypothetical protein DKFZP686K21156; homeobox doma | 99.74 | |
| 2dn0_A | 76 | Zinc fingers and homeoboxes protein 3; triple home | 99.74 | |
| 3rkq_A | 58 | Homeobox protein NKX-2.5; helix-turn-helix, DNA bi | 99.73 | |
| 1akh_A | 61 | Protein (mating-type protein A-1); complex (TWO DN | 99.73 | |
| 1wh7_A | 80 | ZF-HD homeobox family protein; homeobox domain, st | 99.73 | |
| 2da5_A | 75 | Zinc fingers and homeoboxes protein 3; homeobox do | 99.73 | |
| 1puf_B | 73 | PRE-B-cell leukemia transcription factor-1; homeod | 99.72 | |
| 2cuf_A | 95 | FLJ21616 protein; homeobox domain, hepatocyte tran | 99.72 | |
| 2da6_A | 102 | Hepatocyte nuclear factor 1-beta; homeobox domain, | 99.72 | |
| 1b72_B | 87 | Protein (PBX1); homeodomain, DNA, complex, DNA-bin | 99.72 | |
| 1du6_A | 64 | PBX1, homeobox protein PBX1; homeodomain, gene reg | 99.72 | |
| 3nar_A | 96 | ZHX1, zinc fingers and homeoboxes protein 1; corep | 99.71 | |
| 1x2n_A | 73 | Homeobox protein pknox1; homeobox domain, structur | 99.71 | |
| 3nau_A | 66 | Zinc fingers and homeoboxes protein 2; ZHX2, corep | 99.71 | |
| 1puf_B | 73 | PRE-B-cell leukemia transcription factor-1; homeod | 99.71 | |
| 3nar_A | 96 | ZHX1, zinc fingers and homeoboxes protein 1; corep | 99.71 | |
| 1k61_A | 60 | Mating-type protein alpha-2; protein-DNA complex, | 99.71 | |
| 2da6_A | 102 | Hepatocyte nuclear factor 1-beta; homeobox domain, | 99.7 | |
| 2l9r_A | 69 | Homeobox protein NKX-3.1; structural genomics, nor | 99.7 | |
| 1du6_A | 64 | PBX1, homeobox protein PBX1; homeodomain, gene reg | 99.7 | |
| 2dmn_A | 83 | Homeobox protein TGIF2LX; TGFB-induced factor 2-li | 99.7 | |
| 1k61_A | 60 | Mating-type protein alpha-2; protein-DNA complex, | 99.69 | |
| 2dmp_A | 89 | Zinc fingers and homeoboxes protein 2; homeobox do | 99.69 | |
| 3nau_A | 66 | Zinc fingers and homeoboxes protein 2; ZHX2, corep | 99.69 | |
| 1b72_B | 87 | Protein (PBX1); homeodomain, DNA, complex, DNA-bin | 99.68 | |
| 2xsd_C | 164 | POU domain, class 3, transcription factor 1; trans | 99.68 | |
| 1wi3_A | 71 | DNA-binding protein SATB2; homeodomain, helix-turn | 99.68 | |
| 1mnm_C | 87 | Protein (MAT alpha-2 transcriptional repressor); t | 99.68 | |
| 2dmp_A | 89 | Zinc fingers and homeoboxes protein 2; homeobox do | 99.68 | |
| 1le8_B | 83 | Mating-type protein alpha-2; matalpha2, isothermal | 99.67 | |
| 1au7_A | 146 | Protein PIT-1, GHF-1; complex (DNA-binding protein | 99.67 | |
| 1lfb_A | 99 | Liver transcription factor (LFB1); transcription r | 99.67 | |
| 2cqx_A | 72 | LAG1 longevity assurance homolog 5; homeodomain, D | 99.67 | |
| 2l9r_A | 69 | Homeobox protein NKX-3.1; structural genomics, nor | 99.67 | |
| 2cqx_A | 72 | LAG1 longevity assurance homolog 5; homeodomain, D | 99.65 | |
| 1mnm_C | 87 | Protein (MAT alpha-2 transcriptional repressor); t | 99.65 | |
| 3d1n_I | 151 | POU domain, class 6, transcription factor 1; prote | 99.65 | |
| 2e19_A | 64 | Transcription factor 8; homeobox domain, structura | 99.65 | |
| 1e3o_C | 160 | Octamer-binding transcription factor 1; transcript | 99.65 | |
| 2xsd_C | 164 | POU domain, class 3, transcription factor 1; trans | 99.65 | |
| 1le8_B | 83 | Mating-type protein alpha-2; matalpha2, isothermal | 99.65 | |
| 1au7_A | 146 | Protein PIT-1, GHF-1; complex (DNA-binding protein | 99.64 | |
| 1lfb_A | 99 | Liver transcription factor (LFB1); transcription r | 99.64 | |
| 2e19_A | 64 | Transcription factor 8; homeobox domain, structura | 99.63 | |
| 1e3o_C | 160 | Octamer-binding transcription factor 1; transcript | 99.63 | |
| 1x2m_A | 64 | LAG1 longevity assurance homolog 6; homeobox domai | 99.63 | |
| 3d1n_I | 151 | POU domain, class 6, transcription factor 1; prote | 99.63 | |
| 3l1p_A | 155 | POU domain, class 5, transcription factor 1; POU, | 99.62 | |
| 1x2m_A | 64 | LAG1 longevity assurance homolog 6; homeobox domai | 99.61 | |
| 2d5v_A | 164 | Hepatocyte nuclear factor 6; transcription factor, | 99.61 | |
| 3l1p_A | 155 | POU domain, class 5, transcription factor 1; POU, | 99.6 | |
| 3k2a_A | 67 | Homeobox protein MEIS2; homeobox domain, DNA-bindi | 99.58 | |
| 2d5v_A | 164 | Hepatocyte nuclear factor 6; transcription factor, | 99.56 | |
| 3k2a_A | 67 | Homeobox protein MEIS2; homeobox domain, DNA-bindi | 99.56 | |
| 2da7_A | 71 | Zinc finger homeobox protein 1B; homeobox domain, | 99.5 | |
| 2lk2_A | 89 | Homeobox protein TGIF1; NESG, structural genomics, | 99.49 | |
| 2lk2_A | 89 | Homeobox protein TGIF1; NESG, structural genomics, | 99.47 | |
| 2da7_A | 71 | Zinc finger homeobox protein 1B; homeobox domain, | 99.47 | |
| 1ic8_A | 194 | Hepatocyte nuclear factor 1-alpha; transcription r | 99.45 | |
| 2h8r_A | 221 | Hepatocyte nuclear factor 1-beta; trasncription fa | 99.41 | |
| 1ic8_A | 194 | Hepatocyte nuclear factor 1-alpha; transcription r | 99.4 | |
| 2h8r_A | 221 | Hepatocyte nuclear factor 1-beta; trasncription fa | 99.32 | |
| 1mh3_A | 421 | Maltose binding-A1 homeodomain protein chimera; MA | 99.15 | |
| 1mh3_A | 421 | Maltose binding-A1 homeodomain protein chimera; MA | 99.14 | |
| 2nzz_A | 37 | Penetratin conjugated GAS (374-394) peptide; confo | 98.5 | |
| 2nzz_A | 37 | Penetratin conjugated GAS (374-394) peptide; confo | 98.36 | |
| 2ys9_A | 70 | Homeobox and leucine zipper protein homez; homeodo | 96.82 | |
| 2ys9_A | 70 | Homeobox and leucine zipper protein homez; homeodo | 96.73 | |
| 1u78_A | 141 | TC3 transposase, transposable element TC3 transpos | 91.06 | |
| 2k27_A | 159 | Paired box protein PAX-8; paired domain, solution | 90.08 | |
| 1pdn_C | 128 | Protein (PRD paired); protein-DNA complex, double | 87.82 | |
| 2glo_A | 59 | Brinker CG9653-PA; protein-DNA complex, helix-turn | 85.87 | |
| 2elh_A | 87 | CG11849-PA, LD40883P; structural genomics, NPPSFA, | 85.54 | |
| 2glo_A | 59 | Brinker CG9653-PA; protein-DNA complex, helix-turn | 84.68 | |
| 1k78_A | 149 | Paired box protein PAX5; paired domain, ETS domain | 84.04 |
| >2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.81 E-value=5.6e-20 Score=120.64 Aligned_cols=65 Identities=31% Similarity=0.596 Sum_probs=61.1
Q ss_pred CCCCCCCCCCCCCHHHHHHHHHHhhhCCCCCHHHHHHHHHHhCCChHHHHHHhhcchhHHHHHhh
Q psy11996 6 ANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHK 70 (222)
Q Consensus 6 ~~~~~~r~R~~~t~~q~~~L~~~f~~~~~p~~~~~~~la~~~~l~~~~v~~WF~nrR~k~~~~~~ 70 (222)
.+...+|.|+.||.+|+.+|+..|..++||+..+++.||..+||++.+|++||+|||+++++...
T Consensus 3 ~~~~~rr~Rt~ft~~q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~~WFqNrR~k~rr~~~ 67 (70)
T 2dmu_A 3 SGSSGRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRSGP 67 (70)
T ss_dssp STTSSCCCCCCCCHHHHHHHHHHHHHCSSCCHHHHHHHHHHHTCCHHHHHHHHHHHHHHHHHTST
T ss_pred CCCCCCCCCCCCCHHHHHHHHHHHHccCCCCHHHHHHHHHHHCCCHHHeehccccccccccccCC
Confidence 45678899999999999999999999999999999999999999999999999999999998654
|
| >1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A | Back alignment and structure |
|---|
| >2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* | Back alignment and structure |
|---|
| >2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} | Back alignment and structure |
|---|
| >1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A | Back alignment and structure |
|---|
| >2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A | Back alignment and structure |
|---|
| >2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A | Back alignment and structure |
|---|
| >1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* | Back alignment and structure |
|---|
| >2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} | Back alignment and structure |
|---|
| >2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} | Back alignment and structure |
|---|
| >2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A | Back alignment and structure |
|---|
| >1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P | Back alignment and structure |
|---|
| >1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* | Back alignment and structure |
|---|
| >2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} | Back alignment and structure |
|---|
| >2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B | Back alignment and structure |
|---|
| >2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* | Back alignment and structure |
|---|
| >2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P | Back alignment and structure |
|---|
| >2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A | Back alignment and structure |
|---|
| >1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A | Back alignment and structure |
|---|
| >3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A | Back alignment and structure |
|---|
| >3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A | Back alignment and structure |
|---|
| >1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* | Back alignment and structure |
|---|
| >2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A | Back alignment and structure |
|---|
| >1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B | Back alignment and structure |
|---|
| >1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* | Back alignment and structure |
|---|
| >1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* | Back alignment and structure |
|---|
| >1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* | Back alignment and structure |
|---|
| >1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* | Back alignment and structure |
|---|
| >2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P | Back alignment and structure |
|---|
| >1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* | Back alignment and structure |
|---|
| >3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P | Back alignment and structure |
|---|
| >2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* | Back alignment and structure |
|---|
| >1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 | Back alignment and structure |
|---|
| >1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A | Back alignment and structure |
|---|
| >2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A | Back alignment and structure |
|---|
| >2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* | Back alignment and structure |
|---|
| >1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 | Back alignment and structure |
|---|
| >1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A | Back alignment and structure |
|---|
| >2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A | Back alignment and structure |
|---|
| >1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A | Back alignment and structure |
|---|
| >1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A | Back alignment and structure |
|---|
| >3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A | Back alignment and structure |
|---|
| >3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A | Back alignment and structure |
|---|
| >3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 | Back alignment and structure |
|---|
| >2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 | Back alignment and structure |
|---|
| >2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A | Back alignment and structure |
|---|
| >1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A | Back alignment and structure |
|---|
| >2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A | Back alignment and structure |
|---|
| >2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A | Back alignment and structure |
|---|
| >2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 | Back alignment and structure |
|---|
| >2k27_A Paired box protein PAX-8; paired domain, solution structure, triple frequency, 3D NMR, induced FIT, alternative splicing, developmental protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1pdn_C Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} SCOP: a.4.1.5 | Back alignment and structure |
|---|
| >2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1k78_A Paired box protein PAX5; paired domain, ETS domain, transcription factor, transcription/DNA complex; 2.25A {Homo sapiens} SCOP: a.4.1.5 a.4.1.5 PDB: 1mdm_A 6pax_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 222 | ||||
| d9anta_ | 56 | a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila | 1e-21 | |
| d9anta_ | 56 | a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila | 1e-21 | |
| d1pufa_ | 77 | a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m | 2e-21 | |
| d1pufa_ | 77 | a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m | 2e-21 | |
| d2cuea1 | 68 | a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H | 5e-21 | |
| d2cuea1 | 68 | a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H | 5e-21 | |
| d2e1oa1 | 57 | a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo | 6e-19 | |
| d2e1oa1 | 57 | a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo | 6e-19 | |
| d2craa1 | 58 | a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( | 2e-18 | |
| d2craa1 | 58 | a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( | 2e-18 | |
| d1b72a_ | 88 | a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo | 3e-18 | |
| d1b72a_ | 88 | a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo | 3e-18 | |
| d1fjla_ | 65 | a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila | 3e-17 | |
| d1fjla_ | 65 | a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila | 3e-17 | |
| d1bw5a_ | 66 | a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { | 5e-17 | |
| d1bw5a_ | 66 | a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { | 5e-17 | |
| d1p7ia_ | 53 | a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel | 6e-17 | |
| d1p7ia_ | 53 | a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel | 6e-17 | |
| d2cufa1 | 82 | a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM | 8e-17 | |
| d2cufa1 | 82 | a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM | 8e-17 | |
| d1jgga_ | 57 | a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( | 3e-16 | |
| d1jgga_ | 57 | a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( | 3e-16 | |
| d1zq3p1 | 67 | a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl | 4e-16 | |
| d1zq3p1 | 67 | a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl | 4e-16 | |
| d1ig7a_ | 58 | a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu | 6e-16 | |
| d1ig7a_ | 58 | a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu | 6e-16 | |
| d1vnda_ | 77 | a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi | 7e-16 | |
| d1vnda_ | 77 | a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi | 2e-15 | |
| d1ftta_ | 68 | a.4.1.1 (A:) Thyroid transcription factor 1 homeod | 1e-15 | |
| d1ftta_ | 68 | a.4.1.1 (A:) Thyroid transcription factor 1 homeod | 1e-15 | |
| d1yz8p1 | 60 | a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo | 1e-15 | |
| d1yz8p1 | 60 | a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo | 1e-15 | |
| d1x2ma1 | 52 | a.4.1.1 (A:8-59) Lag1 longevity assurance homolog | 2e-15 | |
| d1x2ma1 | 52 | a.4.1.1 (A:8-59) Lag1 longevity assurance homolog | 2e-15 | |
| d1s7ea1 | 50 | a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M | 4e-15 | |
| d1s7ea1 | 50 | a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M | 4e-15 | |
| d1uhsa_ | 72 | a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse | 8e-15 | |
| d1uhsa_ | 72 | a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse | 8e-15 | |
| d1au7a1 | 58 | a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra | 8e-15 | |
| d1au7a1 | 58 | a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra | 8e-15 | |
| d1x2na1 | 62 | a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H | 9e-15 | |
| d1x2na1 | 62 | a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H | 9e-15 | |
| d1le8a_ | 53 | a.4.1.1 (A:) Mating type protein A1 Homeodomain {B | 4e-14 | |
| d1le8a_ | 53 | a.4.1.1 (A:) Mating type protein A1 Homeodomain {B | 4e-14 | |
| d2cqxa1 | 59 | a.4.1.1 (A:8-66) LAG1 longevity assurance homolog | 1e-13 | |
| d2cqxa1 | 59 | a.4.1.1 (A:8-66) LAG1 longevity assurance homolog | 1e-13 | |
| d1wi3a_ | 71 | a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom | 3e-13 | |
| d1wi3a_ | 71 | a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom | 3e-13 | |
| d1k61a_ | 60 | a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast | 4e-13 | |
| d1k61a_ | 60 | a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast | 4e-13 | |
| d2ecba1 | 76 | a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote | 5e-13 | |
| d2ecba1 | 76 | a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote | 2e-12 | |
| d1pufb_ | 73 | a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 | 7e-13 | |
| d1pufb_ | 73 | a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 | 9e-13 | |
| d1ocpa_ | 67 | a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus | 1e-12 | |
| d1ocpa_ | 67 | a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus | 1e-12 | |
| d1e3oc1 | 57 | a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( | 3e-12 | |
| d1e3oc1 | 57 | a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( | 3e-12 | |
| d1wh7a_ | 80 | a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha | 3e-11 | |
| d1wh7a_ | 80 | a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha | 3e-11 | |
| d1lfba_ | 78 | a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN | 1e-10 | |
| d1lfba_ | 78 | a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN | 1e-10 | |
| d2ecca1 | 76 | a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H | 7e-09 | |
| d2ecca1 | 76 | a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H | 7e-09 |
| >d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Homeodomain domain: Antennapedia Homeodomain species: Drosophila melanogaster [TaxId: 7227]
Score = 82.1 bits (203), Expect = 1e-21
Identities = 52/56 (92%), Positives = 54/56 (96%)
Query: 14 RTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEH 69
R +YTRYQTLELEKEFHFNRYLTRRRRIEIAHAL LTERQIKIWFQNRRMKWKKE+
Sbjct: 1 RQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEN 56
|
| >d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 | Back information, alignment and structure |
|---|
| >d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 | Back information, alignment and structure |
|---|
| >d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 | Back information, alignment and structure |
|---|
| >d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 | Back information, alignment and structure |
|---|
| >d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 | Back information, alignment and structure |
|---|
| >d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 | Back information, alignment and structure |
|---|
| >d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 | Back information, alignment and structure |
|---|
| >d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 | Back information, alignment and structure |
|---|
| >d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 | Back information, alignment and structure |
|---|
| >d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 | Back information, alignment and structure |
|---|
| >d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 | Back information, alignment and structure |
|---|
| >d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 | Back information, alignment and structure |
|---|
| >d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 | Back information, alignment and structure |
|---|
| >d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 | Back information, alignment and structure |
|---|
| >d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 | Back information, alignment and structure |
|---|
| >d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 | Back information, alignment and structure |
|---|
| >d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 | Back information, alignment and structure |
|---|
| >d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 | Back information, alignment and structure |
|---|
| >d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 | Back information, alignment and structure |
|---|
| >d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 | Back information, alignment and structure |
|---|
| >d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 | Back information, alignment and structure |
|---|
| >d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 | Back information, alignment and structure |
|---|
| >d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 | Back information, alignment and structure |
|---|
| >d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 | Back information, alignment and structure |
|---|
| >d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 | Back information, alignment and structure |
|---|
| >d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 | Back information, alignment and structure |
|---|
| >d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 | Back information, alignment and structure |
|---|
| >d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 | Back information, alignment and structure |
|---|
| >d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 | Back information, alignment and structure |
|---|
| >d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 | Back information, alignment and structure |
|---|
| >d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 | Back information, alignment and structure |
|---|
| >d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 | Back information, alignment and structure |
|---|
| >d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 | Back information, alignment and structure |
|---|
| >d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 | Back information, alignment and structure |
|---|
| >d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 | Back information, alignment and structure |
|---|
| >d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 | Back information, alignment and structure |
|---|
| >d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 | Back information, alignment and structure |
|---|
| >d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 | Back information, alignment and structure |
|---|
| >d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 | Back information, alignment and structure |
|---|
| >d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 222 | |||
| d2craa1 | 58 | Homeobox protein hox-b13 {Human (Homo sapiens) [Ta | 99.86 | |
| d1ig7a_ | 58 | Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 | 99.84 | |
| d1zq3p1 | 67 | Homeotic bicoid protein {Fruit fly (Drosophila mel | 99.84 | |
| d2e1oa1 | 57 | Homeobox protein prh {Human (Homo sapiens) [TaxId: | 99.84 | |
| d2craa1 | 58 | Homeobox protein hox-b13 {Human (Homo sapiens) [Ta | 99.84 | |
| d1jgga_ | 57 | Even-skipped homeodomain {Fruit fly (Drosophila me | 99.84 | |
| d1pufa_ | 77 | Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax | 99.84 | |
| d9anta_ | 56 | Antennapedia Homeodomain {Drosophila melanogaster | 99.83 | |
| d1p7ia_ | 53 | Engrailed Homeodomain {Drosophila melanogaster [Ta | 99.83 | |
| d1fjla_ | 65 | Paired protein {Fruit fly (Drosophila melanogaster | 99.83 | |
| d2cuea1 | 68 | Paired box protein pax6 {Human (Homo sapiens) [Tax | 99.83 | |
| d2e1oa1 | 57 | Homeobox protein prh {Human (Homo sapiens) [TaxId: | 99.83 | |
| d9anta_ | 56 | Antennapedia Homeodomain {Drosophila melanogaster | 99.83 | |
| d1ig7a_ | 58 | Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 | 99.82 | |
| d1ftta_ | 68 | Thyroid transcription factor 1 homeodomain {Rat (R | 99.82 | |
| d1jgga_ | 57 | Even-skipped homeodomain {Fruit fly (Drosophila me | 99.82 | |
| d1b72a_ | 88 | Homeobox protein hox-b1 {Human (Homo sapiens) [Tax | 99.82 | |
| d1vnda_ | 77 | VND/NK-2 protein {Fruit fly (Drosophila melanogast | 99.82 | |
| d1vnda_ | 77 | VND/NK-2 protein {Fruit fly (Drosophila melanogast | 99.82 | |
| d1zq3p1 | 67 | Homeotic bicoid protein {Fruit fly (Drosophila mel | 99.81 | |
| d1pufa_ | 77 | Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax | 99.81 | |
| d1yz8p1 | 60 | Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: | 99.81 | |
| d1b72a_ | 88 | Homeobox protein hox-b1 {Human (Homo sapiens) [Tax | 99.81 | |
| d1fjla_ | 65 | Paired protein {Fruit fly (Drosophila melanogaster | 99.81 | |
| d1p7ia_ | 53 | Engrailed Homeodomain {Drosophila melanogaster [Ta | 99.8 | |
| d1uhsa_ | 72 | Homeodomain-only protein, Hop {Mouse (Mus musculus | 99.8 | |
| d2cuea1 | 68 | Paired box protein pax6 {Human (Homo sapiens) [Tax | 99.8 | |
| d1ftta_ | 68 | Thyroid transcription factor 1 homeodomain {Rat (R | 99.8 | |
| d1uhsa_ | 72 | Homeodomain-only protein, Hop {Mouse (Mus musculus | 99.79 | |
| d1bw5a_ | 66 | Insulin gene enhancer protein isl-1 {Rat (Rattus n | 99.79 | |
| d1ocpa_ | 67 | Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId | 99.79 | |
| d1yz8p1 | 60 | Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: | 99.78 | |
| d1le8a_ | 53 | Mating type protein A1 Homeodomain {Baker's yeast | 99.78 | |
| d1au7a1 | 58 | Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta | 99.78 | |
| d2cufa1 | 82 | Homeobox-containing protein 1, HMBOX1 (Flj21616) { | 99.77 | |
| d1wi3a_ | 71 | DNA-binding protein SATB2 {Human (Homo sapiens) [T | 99.77 | |
| d1bw5a_ | 66 | Insulin gene enhancer protein isl-1 {Rat (Rattus n | 99.77 | |
| d1au7a1 | 58 | Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta | 99.77 | |
| d1le8a_ | 53 | Mating type protein A1 Homeodomain {Baker's yeast | 99.77 | |
| d1ocpa_ | 67 | Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId | 99.76 | |
| d1e3oc1 | 57 | Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId | 99.75 | |
| d1e3oc1 | 57 | Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId | 99.75 | |
| d2cufa1 | 82 | Homeobox-containing protein 1, HMBOX1 (Flj21616) { | 99.75 | |
| d1wi3a_ | 71 | DNA-binding protein SATB2 {Human (Homo sapiens) [T | 99.75 | |
| d1s7ea1 | 50 | Hepatocyte nuclear factor 6 {Mouse (Mus musculus) | 99.74 | |
| d1wh7a_ | 80 | ZF-HD homeobox protein At4g24660 {Thale cress (Ara | 99.73 | |
| d2ecba1 | 76 | Zinc fingers and homeoboxes protein 1, ZHX1 {Human | 99.72 | |
| d1s7ea1 | 50 | Hepatocyte nuclear factor 6 {Mouse (Mus musculus) | 99.72 | |
| d2ecba1 | 76 | Zinc fingers and homeoboxes protein 1, ZHX1 {Human | 99.71 | |
| d1wh7a_ | 80 | ZF-HD homeobox protein At4g24660 {Thale cress (Ara | 99.7 | |
| d2ecca1 | 76 | Homeobox-leucine zipper protein Homez {Human (Homo | 99.7 | |
| d1pufb_ | 73 | pbx1 {Human (Homo sapiens) [TaxId: 9606]} | 99.7 | |
| d2ecca1 | 76 | Homeobox-leucine zipper protein Homez {Human (Homo | 99.7 | |
| d1pufb_ | 73 | pbx1 {Human (Homo sapiens) [TaxId: 9606]} | 99.67 | |
| d1lfba_ | 78 | Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat | 99.65 | |
| d1x2ma1 | 52 | Lag1 longevity assurance homolog 6, LASS6 {Mouse ( | 99.65 | |
| d1lfba_ | 78 | Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat | 99.65 | |
| d1x2ma1 | 52 | Lag1 longevity assurance homolog 6, LASS6 {Mouse ( | 99.63 | |
| d1x2na1 | 62 | Homeobox protein pknox1 {Human (Homo sapiens) [Tax | 99.63 | |
| d1k61a_ | 60 | mat alpha2 Homeodomain {Baker's yeast (Saccharomyc | 99.61 | |
| d2cqxa1 | 59 | LAG1 longevity assurance homolog 5, LASS5 {Mouse ( | 99.61 | |
| d1k61a_ | 60 | mat alpha2 Homeodomain {Baker's yeast (Saccharomyc | 99.6 | |
| d1x2na1 | 62 | Homeobox protein pknox1 {Human (Homo sapiens) [Tax | 99.6 | |
| d2cqxa1 | 59 | LAG1 longevity assurance homolog 5, LASS5 {Mouse ( | 99.59 | |
| d1hlva1 | 66 | DNA-binding domain of centromere binding protein B | 92.3 | |
| d1ijwc_ | 47 | HIN recombinase (DNA-binding domain) {Synthetic} | 92.08 | |
| d1ijwc_ | 47 | HIN recombinase (DNA-binding domain) {Synthetic} | 90.71 | |
| d1hlva1 | 66 | DNA-binding domain of centromere binding protein B | 90.37 |
| >d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Homeodomain domain: Homeobox protein hox-b13 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.86 E-value=2.2e-22 Score=124.68 Aligned_cols=58 Identities=47% Similarity=0.785 Sum_probs=55.4
Q ss_pred CCCCCCCCCHHHHHHHHHHhhhCCCCCHHHHHHHHHHhCCChHHHHHHhhcchhHHHH
Q psy11996 10 TKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK 67 (222)
Q Consensus 10 ~~r~R~~~t~~q~~~L~~~f~~~~~p~~~~~~~la~~~~l~~~~v~~WF~nrR~k~~~ 67 (222)
+||+|+.||.+|+.+|+..|..++||+..++++||..+||++.+|++||||||++++|
T Consensus 1 Grr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~vWFqNrR~k~kk 58 (58)
T d2craa1 1 GRKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKK 58 (58)
T ss_dssp CCCSCCCSCHHHHHHHHHHHHHCSSCCHHHHHHHHHHTCCCHHHHHHHHHHHHHTTTS
T ss_pred CCCCCCCCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCHHHeeecccchhhhccC
Confidence 4788999999999999999999999999999999999999999999999999998764
|
| >d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} | Back information, alignment and structure |
|---|
| >d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} | Back information, alignment and structure |
|---|
| >d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|