Diaphorina citri psyllid: psy12002


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----
MTLFQGSDNHDLIKHNLVVFRGGEGALQVLPPLIDVIPESRLNLVIYHLKQAWDLYLTMDTSPESLQILQLIANESYRRAKFWFAFKAFDMLERLEPLAEYWEGKRGACAGLMQMIMAGKENRLNVPWAKCALGQYKEAEEMFLLVQNEGLKNDYVYISHLTKC
cccccccccHHHHHccEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHccHHHHHHHHHHHcccccccHHHHHHHHccc
*********HDLIKHNLVVFRGGEGALQVLPPLIDVIPESRLNLVIYHLKQAWDLYLTMDTSPESLQILQLIANESYRRAKFWFAFKAFDMLERLEPLAEYWEGKRGACAGLMQMIMAGKENRLNVPWAKCALGQYKEAEEMFLLVQNEGLKNDYVYISHLTKC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLFQGSDNHDLIKHNLVVFRGGEGALQVLPPLIDVIPESRLNLVIYHLKQAWDLYLTMDTSPESLQILQLIANESYRRAKFWFAFKAFDMLERLEPLAEYWEGKRGACAGLMQMIMAGKENRLNVPWAKCALGQYKEAEEMFLLVQNEGLKNDYVYISHLTKC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008594 [BP]photoreceptor cell morphogenesisprobableGO:0032502, GO:0030154, GO:0048468, GO:0009653, GO:0007275, GO:0044699, GO:0042461, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0000904, GO:0044763, GO:0048731, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0046530, GO:0008150
GO:0036064 [CC]cilium basal bodyprobableGO:0043229, GO:0043228, GO:0005929, GO:0043227, GO:0043226, GO:0005856, GO:0044446, GO:0031514, GO:0005815, GO:0044430, GO:0015630, GO:0042995, GO:0005932, GO:0043231, GO:0043232, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044441, GO:0044424, GO:0044422
GO:0072372 [CC]primary ciliumprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PL2, chain A
Confidence level:probable
Coverage over the Query: 18-148
View the alignment between query and template
View the model in PyMOL