Diaphorina citri psyllid: psy12033


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------8
MPFFSKFTFRFGLDSSCGQRILPIDMAIILWKLVFSIRVSCDESFILTAWLNFLSQHTHVVRGIPRDTWNMFLTFYDTI
cccEEEEEEEECcccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcc
MPFFSKFTFRFGLDSSCGQRILPIDMAIILWKLVFSIRVSCDESFILTAWLNFLSQHTHVVRGIPRDTWNMFLTFYDTI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPFFSKFTFRFGLDSSCGQRILPIDMAIILWKLVFSIRVSCDESFILTAWLNFLSQHTHVVRGIPRDTWNMFLTFYDTI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DCN1-like protein 3 confidentQ8K0V2
DCN1-like protein 3 confidentQ4V8B2
DCN1-like protein 3 confidentQ8IWE4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0010332 [BP]response to gamma radiationprobableGO:0008150, GO:0009314, GO:0050896, GO:0010212, GO:0009628
GO:0010225 [BP]response to UV-CprobableGO:0009628, GO:0009314, GO:0050896, GO:0009411, GO:0008150, GO:0009416

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TDU, chain A
Confidence level:very confident
Coverage over the Query: 2-79
View the alignment between query and template
View the model in PyMOL