Diaphorina citri psyllid: psy12048

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------

MGVYIQPSRRPDGTFRKAIRVKAGYVPQDEVPLYESKGKQFANRQAAQSIPIGLDPSHVKKPVNPQNPIPGLVILDADDLGYVPQDEVPLYESKGKQFANRQAAQSIPIGLDPSHVKKPVNPQNPIPGLPPAPSELNFDNLSPEELEKRIKNLKKKVREITVQVTHPVEMPRQLNLKVSLKPPAPSELNFDNLSPEELEKRIKNLKKKVREIKTLEQKIESGEIKNPEKDQLEKLQRKPDLLSEIMALKLSLHGEEGEGEGTHAKYT

cccccccccccccccccccccccccccccccccHHcccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcHHHHHHHHHHHHHHcccccccccccccccc

********RRPDGTF*KAIRVKAGYVPQDEVPLY*************************************LVILDA*DLGYVPQDEVPL**********************************************************************************************************************VR************************LQR*PDLL*************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGVYIQPSRRPDGTFRKAIRVKAGYVPQDEVPLYESKGKQFANRQAAQSIPIGLDPSHVKKPVNPQNPIPGLVILDADDLGYVPQDEVPLYESKGKQFANRQAAQSIPIGLDPSHVKKPVNPQNPIPGLPPAPSELNFDNLSxxxxxxxxxxxxxxxxxxxxxVTHPVEMPRQLNLKVSLKPPAPSELNFDNLSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNPEKDQLEKLQRKPDLLSEIMALKLSLHGEEGEGEGTHAKYT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0043022 [MF]	ribosome binding	probable	GO:0043021, GO:0003674, GO:0005488
GO:0045727 [BP]	positive regulation of translation	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010608, GO:0009891, GO:2000112, GO:0051247, GO:0051246, GO:0032270, GO:0048518, GO:0065007, GO:0010468, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0032268, GO:0010557, GO:0010556, GO:0006417, GO:0048522
GO:0035145 [CC]	exon-exon junction complex	probable	GO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0003723 [MF]	RNA binding	probable	GO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0000184 [BP]	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	probable	GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006401, GO:0006402, GO:0044238, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0016071, GO:0044270, GO:0044237, GO:0043170, GO:0000956, GO:0019439

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1RK8, chain C
Confidence level:very confident
Coverage over the Query: 2-27
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
1rk8, chain C		very confident	Alignment \| Template Structure