Diaphorina citri psyllid: psy12053


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------
MSKNPKTSKAVNTRPRPNTVLTGGGYWGSRPPSPSGGDNASETSSVMPPPPPQQTQRPKSRAESKYDNLSYWRARKVTFFKNGDPYFPGVEYRFKPGRDIPSLEALQDKLSVRMDLPRGARYVFSMDGVRILTLDELEDNASYVVSSYKTFKVRFYPFVFTYLLVRG
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccccccEEEEEccccccccHHHHHHHHHccccccccccEEEcccccccccHHHHccccEEEEEcccccccccccEEEEEEEEcc
*******************************************************************NLSYWRARKVTFFKNGDPYFPGVEYRFKPGRDIPSLEALQDKLSVRMDLPRGARYVFSMDGVRILTLDELEDNASYVVSSYKTFKVRFYPFVFTYLLVR*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKNPKTSKAVNTRPRPNTVLTGGGYWGSRPPSPSGGDNASETSSVMPPPPPQQTQRPKSRAESKYDNLSYWRARKVTFFKNGDPYFPGVEYRFKPGRDIPSLEALQDKLSVRMDLPRGARYVFSMDGVRILTLDELEDNASYVVSSYKTFKVRFYPFVFTYLLVRG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Echinoderm microtubule-associated protein-like CG42247 May modify the assembly dynamics of microtubules, such that microtubules are slightly longer, but more dynamic.confidentQ9VUI3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031513 [CC]nonmotile primary ciliumprobableGO:0072372, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0071683 [CC]sensory dendriteprobableGO:0044464, GO:0030425, GO:0005575, GO:0097458, GO:0005623, GO:0043005, GO:0042995
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0015630 [CC]microtubule cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0008017 [MF]microtubule bindingprobableGO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1MG4, chain A
Confidence level:very confident
Coverage over the Query: 72-160
View the alignment between query and template
View the model in PyMOL