Diaphorina citri psyllid: psy12057

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--
MSCPWTVVWVLISIHNMCFKFQPIAWLSTHSMAIKTSSVNTILLELFLAMDIYSRLLIFPGKRRRETGGFPGASIIQSQIKSGVSRKRTGLTSTGVPIRPGYEIFNANDQRVGAITSGCPSPSLKKNIAMGYIEPAYSKVGVELWVRVRDKRVDVKVTKMPFLKSNYHTPPK
ccccHHHHHHHHHHcccccccECccccccccccccccccccccccccccccHHcccccccccccccccccccHHHHHHHHHccccccEEEEECcccccccccEEEcccccEEEEEccccccccccccEEEEEEcccccccccEEEEEEccccccEEEEcccccccccccccc
MSCPWTVVWVLISIHNMCFKFQPIAWLSTHSMAIKTSSVNTILLELFLAMDIYSRLLIFPGKRRRETGGFPGASIIQSQIKSGVSRKRTGLTSTGVPIRPGYEIFNANDQRVGAITSGCPSPSLKKNIAMGYIEPAYSKVGVELWVRVRDKRVDVKVTKMPFLK*NY*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSCPWTVVWVLISIHNMCFKFQPIAWLSTHSMAIKTSSVNTILLELFLAMDIYSRLLIFPGKRRRETGGFPGASIIQSQIKSGVSRKRTGLTSTGVPIRPGYEIFNANDQRVGAITSGCPSPSLKKNIAMGYIEPAYSKVGVELWVRVRDKRVDVKVTKMPFLKSNYHTPPK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Aminomethyltransferase, mitochondrial The glycine cleavage system catalyzes the degradation of glycine.confidentP28337
Aminomethyltransferase, mitochondrial The glycine cleavage system catalyzes the degradation of glycine.confidentQ9TSZ7
Aminomethyltransferase, mitochondrial The glycine cleavage system catalyzes the degradation of glycine.confidentQ8CFA2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WSR, chain A
Confidence level:very confident
Coverage over the Query: 49-170
View the alignment between query and template
View the model in PyMOL