Diaphorina citri psyllid: psy12064


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MEKSLSPKQCALLDASLDSIKNYFHAAGNGLKKTYLDKSPELASLRYALSLYTQTTDALIKTFVQSQCNEGRDLIGNEEQLEFFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQICVKDYCFARDDRLVGVAVLQLKDIVEQK
ccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHEEEEcccHHHHHHHHHHHEEccccccccccccccEEEEEEEEECcccccccEEEEEEEEEccccHHHHHHcccccccccCEccCEEEEEEEEEHHHHHcc
***SLSPKQCALLDASLDSIKNYFHAAGNGLKKTYLDKSPELASLRYALSLYTQTTDALIKTFVQSQCN***D****EEQLEFFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQICVKDYCFARDDRLVGVAVLQLKDI****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKSLSPKQCALLDASLDSIKNYFHAAGNGLKKTYLDKSPELASLRYALSLYTQTTDALIKTFVQSQCNEGRDLIGNEEQLEFFELHICVKDYCFARDDRLVGVAVLQLKDIVEQVKHQICVKDYCFARDDRLVGVAVLQLKDIVEQK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein unc-13 homolog B Plays a role in vesicle maturation during exocytosis as a target of the diacylglycerol second messenger pathway. Is involved in neurotransmitter release by acting in synaptic vesicle priming prior to vesicle fusion and participates in the activity-depending refilling of readily releasable vesicle pool (RRP). Essential for synaptic vesicle maturation in a subset of excitatory/glutamatergic but not inhibitory/GABA-mediated synapses.confidentO14795
Phorbol ester/diacylglycerol-binding protein unc-13 May form part of a signal transduction pathway, transducing the signal from diacylglycerol to effector functions. One such function could be the release of neurotransmitter from neurons.confidentP27715
Protein unc-13 homolog B Plays a role in vesicle maturation during exocytosis as a target of the diacylglycerol second messenger pathway. Is involved in neurotransmitter release by acting in synaptic vesicle priming prior to vesicle fusion and participates in the activity-depending refilling of readily releasable vesicle pool (RRP), Essential for synaptic vesicle maturation in a subset of excitatory/glutamatergic but not inhibitory/GABA-mediated synapses.confidentQ62769

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031594 [CC]neuromuscular junctionprobableGO:0005575, GO:0045202
GO:0019904 [MF]protein domain specific bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0060076 [CC]excitatory synapseprobableGO:0005575, GO:0045202
GO:0042734 [CC]presynaptic membraneprobableGO:0097060, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0044456, GO:0045202
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0016082 [BP]synaptic vesicle primingprobableGO:0019226, GO:0022607, GO:0007269, GO:0035637, GO:0070271, GO:0043933, GO:0006836, GO:0032940, GO:0032501, GO:0023052, GO:0001505, GO:0034622, GO:0051656, GO:0051650, GO:0044699, GO:0048489, GO:0071822, GO:0006887, GO:0016043, GO:0065003, GO:0065007, GO:0071840, GO:0097479, GO:0065008, GO:0006810, GO:0050877, GO:0003008, GO:0006461, GO:0023061, GO:0044765, GO:0044763, GO:0003001, GO:0007268, GO:0007267, GO:0007154, GO:0051234, GO:0043623, GO:0051179, GO:0097480, GO:0051641, GO:0044700, GO:0046903, GO:0016192, GO:0044707, GO:0051648, GO:0016079, GO:0044085, GO:0051640, GO:0008150, GO:0009987, GO:0051649
GO:0019992 [MF]diacylglycerol bindingprobableGO:0003674, GO:0008289, GO:0005488
GO:0046872 [MF]metal ion bindingprobableGO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0007528 [BP]neuromuscular junction developmentprobableGO:0050808, GO:0030154, GO:0048468, GO:0014706, GO:0051146, GO:0061061, GO:0007275, GO:0071840, GO:0007517, GO:0048869, GO:0007519, GO:0016043, GO:0048513, GO:0044699, GO:0032502, GO:0055001, GO:0055002, GO:0032501, GO:0048741, GO:0009987, GO:0009888, GO:0048747, GO:0044767, GO:0044763, GO:0048731, GO:0044707, GO:0048856, GO:0060537, GO:0060538, GO:0008150, GO:0042692
GO:0048172 [BP]regulation of short-term neuronal synaptic plasticityprobableGO:0010646, GO:0044057, GO:0031644, GO:0050804, GO:0050789, GO:0048167, GO:0065007, GO:0051239, GO:0023051, GO:0008150, GO:0051969, GO:0065008, GO:0048168, GO:0050794
GO:0035556 [BP]intracellular signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0035249 [BP]synaptic transmission, glutamatergicprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0007267, GO:0044763, GO:0023052, GO:0007268, GO:0007270, GO:0007154, GO:0044699, GO:0003008
GO:0060384 [BP]innervationprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0008150, GO:0048731, GO:0021675, GO:0007275, GO:0044699
GO:0017075 [MF]syntaxin-1 bindingprobableGO:0003674, GO:0000149, GO:0019905, GO:0005488, GO:0005515
GO:0016188 [BP]synaptic vesicle maturationprobableGO:0019226, GO:0035637, GO:0051649, GO:0032501, GO:0023052, GO:0051656, GO:0010259, GO:0051650, GO:0044699, GO:0048489, GO:0071840, GO:0016043, GO:0048488, GO:0097479, GO:0051641, GO:0032502, GO:0009987, GO:0050877, GO:0006810, GO:0044767, GO:0044765, GO:0044763, GO:0051648, GO:0007268, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0097480, GO:0003008, GO:0006996, GO:0044700, GO:0006897, GO:0016192, GO:0044707, GO:0016050, GO:0051640, GO:0008150
GO:0050435 [BP]beta-amyloid metabolic processprobableGO:1901564, GO:0043603, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:0006518
GO:0043195 [CC]terminal boutonprobableGO:0044306, GO:0043679, GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0044456, GO:0045202, GO:0043005, GO:0033267, GO:0042995
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0048786 [CC]presynaptic active zoneprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0044456, GO:0045202
GO:0016081 [BP]synaptic vesicle docking involved in exocytosisprobableGO:0019226, GO:0003001, GO:0035637, GO:0051648, GO:0006904, GO:0007268, GO:0022406, GO:0032940, GO:0032501, GO:0023052, GO:0001505, GO:0051656, GO:0051650, GO:0044699, GO:0048489, GO:0006887, GO:0065007, GO:0051640, GO:0097479, GO:0065008, GO:0009987, GO:0050877, GO:0003008, GO:0006810, GO:0023061, GO:0048278, GO:0044765, GO:0044763, GO:0007269, GO:0051649, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0097480, GO:0051641, GO:0044700, GO:0046903, GO:0016192, GO:0044707, GO:0016079, GO:0008150, GO:0006836
GO:0045211 [CC]postsynaptic membraneprobableGO:0097060, GO:0044456, GO:0016020, GO:0005575, GO:0045202
GO:0047485 [MF]protein N-terminus bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0060291 [BP]long-term synaptic potentiationprobableGO:0010646, GO:0044057, GO:0031644, GO:0031646, GO:0051240, GO:0050806, GO:0010647, GO:0050804, GO:0023056, GO:0050789, GO:0048167, GO:0065007, GO:0051239, GO:0023051, GO:0048518, GO:0008150, GO:0051969, GO:0065008, GO:0051971, GO:0050794, GO:0048522
GO:0001956 [BP]positive regulation of neurotransmitter secretionprobableGO:0060341, GO:0051047, GO:0051049, GO:0050804, GO:0023051, GO:0051588, GO:0010646, GO:0050789, GO:0051046, GO:0044057, GO:0065007, GO:0048518, GO:0051050, GO:0050794, GO:0051590, GO:0046928, GO:0008150, GO:0051239, GO:0032879, GO:0031644, GO:0051969, GO:0048522
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SWH, chain A
Confidence level:very confident
Coverage over the Query: 7-52
View the alignment between query and template
View the model in PyMOL
Template: 2DMH, chain A
Confidence level:probable
Coverage over the Query: 82-141
View the alignment between query and template
View the model in PyMOL