Diaphorina citri psyllid: psy12089

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------

MALSDADVQKQIKHMMAFIEQEANAIGDDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQHQRLKIMEYYDRKEKQVELQKKIQSSNMLNQARLKALKVREDHVRNVLDEARKRLGEVTKNRDKYTQLIEKLIIQGLLQLLEPNVLIRSREVDKDIVNAVLPNVAKAYQDVAGKEVNLKLDNDQFLPVDTTGGIELLAQRGKIKISNTLEARLELIAQQIIPDIRVAIFGRNPNLMALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQHQRLKIMEYYDRKEKQVELQKKIQSSNMLNQARLKALKVREDHVRNVLDEARKRLGEVTKNRDKYTQLIEKLIIQGLLQLLEPNVLIRSREVDKDIVNAVLPNVAKAYQDVAGKEVNLKLDNDQFLPVDTTGGIELLAQRGKIKISNTLEARLELIAQQIIPDIRVAIFGRNPN

ccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHHHHHHHccccEEEccccccccccccccEEEEEcccEEEEcccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHHHHHHHccccEEEEcccccccccccccEEEEEccccEEEcccHHHHHHHHHHHHHHHHHHHHcccccc

***************MAFI******************HMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQHQRLKIMEYYD*************************LKVREDHVRNVLDEARKRLGEVTKNRDKYTQLIEKLIIQGLLQLLEPNVLIRSREVDKDIVNAVLPNVAKAYQDVAGKEVNLKLDNDQFLPVDTTGGIELLAQRGKIKISNTLEARLELIAQQIIPDIRVAIFGRNPNLMALSDADVQKQIKHMMAFIEQEANEKAEEIDA*AE*EFNIEKGRLVQHQRLKIMEYYD*************************LKVREDHVRNVLDEARKRLGEVTKNRDKYTQLIEKLIIQGLLQLLEPNVLIRSREVDKDIVNAVLPNVAKAYQDVAGKEVNLKLDNDQFLPVDTTGGIELLAQRGKIKISNTLEARLELIAQQIIPDIRVAIFGR***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MALSDADVQKQIKHMMAFIEQEANAIGDDADVQKQIKHMxxxxxxxxxxxxxxxxxxxxxEFNIEKGRLVQHQRLKIMEYYDRKEKQVELQKKIQSSNMLNQARxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIEKLIIQGLLQLLEPNVLIRSREVDKDIVNAVLPNVAKAYQDVAGKEVNLKLDNDQFLPVDTTGGIELLAQRGKIKISNTLEARLELIAQQIIPDIRVAIFGRNPNLMALSDADVQKQIKHMxxxxxxxxxxxxxxxxxxxxxEFNIEKGRLVQHQRLKIMEYYDRKEKQVELQKKIQSSNMLNQARxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIEKLIIQGLLQLLEPNVLIRSREVDKDIVNAVLPNVAKAYQDVAGKEVNLKLDNDQFLPVDTTGGIELLAQRGKIKISNTLEARLELIAQQIIPDIRVAIFGRNPN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
V-type proton ATPase subunit E	Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.	confident	P54611
V-type proton ATPase subunit E 1	Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.	confident	Q6PCU2
V-type proton ATPase subunit E 1	Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.	confident	P50518

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005768 [CC]	endosome	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005902 [CC]	microvillus	probable	GO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0044699 [BP]	single-organism process	probable	GO:0008150
GO:0005774 [CC]	vacuolar membrane	probable	GO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0006810 [BP]	transport	probable	GO:0051234, GO:0008150, GO:0051179
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0016324 [CC]	apical plasma membrane	probable	GO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0032991 [CC]	macromolecular complex	probable	GO:0005575

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DM9, chain A
Confidence level:very confident
Coverage over the Query: 113-241
View the alignment between query and template
View the model in PyMOL

Template: 2DM9, chain A
Confidence level:very confident
Coverage over the Query: 335-463
View the alignment between query and template
View the model in PyMOL

Template: 4EFA, chain E
Confidence level:very confident
Coverage over the Query: 25-243
View the alignment between query and template
View the model in PyMOL

Template: 4EFA, chain E
Confidence level:very confident
Coverage over the Query: 245-465
View the alignment between query and template
View the model in PyMOL