Diaphorina citri psyllid: psy12096


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170---
MPPFDKREVVQEVLNVISFNASTLPPLVADSIKRKTQATTTTTPLPEDEEEDLEMTEAFEDVSEELSSTVASIKKEIANESMKIADKVAEETGMPPWVVVSIFIERQILEGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQSVEGEGGQIGKT
ccccccHHHHHHHHHccccccccccccccccHHcccccccccccccccccccCEEEEcccccccccccccccEEEEEEcccccEEEcEECcccccccEEEEEEEEcEEEcccccccccccEEEEEEEEccccccccEEEEEEEEcccccccccccEEEEcccccccccccccc
********VVQEVLNVISFNASTLPPL****************************TEAFEDVSEELSSTVASIKKEIANE**********ETGMPPWVVVSIFIERQILEGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWREL*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPPFDKREVVQEVLNVISFNASTLPPLVADSIKRKTQATTTTTPLPEDEEEDLEMTEAFEDVSEELSSTVASIKKEIANESMKIADKVAEETGMPPWVVVSIFIERQILEGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQSVEGEGGQIGKT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Synaptotagmin 1 May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone.confidentP21521

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031594 [CC]neuromuscular junctionprobableGO:0005575, GO:0045202
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0007268 [BP]synaptic transmissionprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0044699, GO:0003008
GO:0060024 [BP]rhythmic synaptic transmissionprobableGO:0050804, GO:0044057, GO:0031644, GO:0050794, GO:0065007, GO:0051239, GO:0023051, GO:0008150, GO:0051969, GO:0010646, GO:0050789

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ENP, chain A
Confidence level:very confident
Coverage over the Query: 46-167
View the alignment between query and template
View the model in PyMOL
Template: 2R83, chain A
Confidence level:very confident
Coverage over the Query: 3-165
View the alignment between query and template
View the model in PyMOL