Psyllid ID: psy12096


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170---
MPPFDKREVVQEVLNVISFNASTLPPLVADSIKRKTQATTTTTPLPEDEEEDLEMTEAFEDVSEELSSTVASIKKEIANESMKIADKVAEETGMPPWVVVSIFIERQILEGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQSVEGEGGQIGKT
ccccccHHHHHHHHHcccccccccccccccHHHHccccccccccccccccccEEEEEcccccccccccccccEEEEEEcccccEEEcEEEcccccccEEEEEEEEcEEEcccccccccccEEEEEEEEccccccccEEEEEEEEcccccccccccEEEEcccccccccccccc
cccHHHcccEEEEEEEEEcccccccccccccccccccccHHHccccccccccccccccccccccEEEEEEcccccEEEEEEEEEccccccccEEEEcccccccccEEEEccccHHHHcccEEEEEEEEcccccccEEEEEEEEEHHHccccccEEEEEEcEcccccccccccc
MPPFDKREVVQEVLNVISfnastlpplvadsikrktqatttttplpedeeedlEMTEAFEDVSEELSSTVASIKKEIANESMKIADKVAeetgmppwVVVSIFIERQilegvpyadAMNKTLVFAIFdfdrfskhdqiGEVKVALCQIDLAQTIEEWRELQsvegeggqigkt
MPPFDKREVVQEVLNVIsfnastlpplvadsikrktqatttttplpedeeedLEMTEAFEDVSEELSSTVASIKKEIANESMKIADKVAEETGMPPWVVVSIFIERQILEGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRelqsvegeggqigkt
MPPFDKREVVQEVLNVISFNASTLPPLVADSIKRKTQAtttttplpedeeedlemteAFEDVSEELSSTVASIKKEIANESMKIADKVAEETGMPPWVVVSIFIERQILEGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQSVEGEGGQIGKT
********VVQEVLNVISFNASTLPPL***************************************************************ETGMPPWVVVSIFIERQILEGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWREL*************
*********VQEVLN*********************************EEEDLEMTEAFEDVSEELSSTVASIKKEIANE***********TGMPPWVVVSIFIERQILEGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEW****************
********VVQEVLNVISFNASTLPPLVADSIKR*********************TEAFEDVSEELSSTVASIKKEIANESMKIADKVAEETGMPPWVVVSIFIERQILEGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQ************
MPPFDKREVVQEVLNVISFNASTLPPLVADSIKRKTQATTTTTP****************DVSEELSSTVASIKKEIANESMKIADKVAEETGMPPWVVVSIFIERQILEGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQSVE*********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPPFDKREVVQEVLNVISFNASTLPPLVADSIKRKTQATTTTTPLPEDEEEDLEMTEAFEDVSEELSSTVASIKKEIANESMKIADKVAEETGMPPWVVVSIFIERQILEGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQSVEGEGGQIGKT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query173 2.2.26 [Sep-21-2011]
P21521 474 Synaptotagmin 1 OS=Drosop yes N/A 0.502 0.183 0.645 8e-27
P46097 422 Synaptotagmin-2 OS=Mus mu yes N/A 0.317 0.130 0.654 2e-14
Q8N9I0 419 Synaptotagmin-2 OS=Homo s yes N/A 0.317 0.131 0.654 3e-14
P29101 422 Synaptotagmin-2 OS=Rattus yes N/A 0.317 0.130 0.654 3e-14
P41823 428 Synaptotagmin-1 OS=Aplysi N/A N/A 0.317 0.128 0.581 8e-14
P47191 424 Synaptotagmin-1 OS=Gallus no N/A 0.317 0.129 0.6 1e-13
P24506 439 Synaptotagmin-B OS=Diplob N/A N/A 0.317 0.125 0.563 4e-13
Q5R4J5 419 Synaptotagmin-1 OS=Pongo yes N/A 0.317 0.131 0.581 6e-13
Q60HC0 419 Synaptotagmin-1 OS=Macaca N/A N/A 0.317 0.131 0.581 6e-13
P48018 422 Synaptotagmin-1 OS=Bos ta no N/A 0.317 0.130 0.581 7e-13
>sp|P21521|SY65_DROME Synaptotagmin 1 OS=Drosophila melanogaster GN=Syt1 PE=1 SV=2 Back     alignment and function desciption
 Score =  119 bits (299), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 60/93 (64%), Positives = 68/93 (73%), Gaps = 6/93 (6%)

Query: 77  IANESMKIADKVAEETGMPPWVVVSIFIERQILEGVPYADAMNKTLVFAIFDFDRFSKHD 136
           + ++  K   KV  +T  P      +F E    + +PYADAMNKTLVFAIFDFDRFSKHD
Sbjct: 237 LPDKKKKFETKVHRKTLSP------VFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHD 290

Query: 137 QIGEVKVALCQIDLAQTIEEWRELQSVEGEGGQ 169
           QIGEVKV LC IDLAQTIEEWR+L SVEGEGGQ
Sbjct: 291 QIGEVKVPLCTIDLAQTIEEWRDLVSVEGEGGQ 323




May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone.
Drosophila melanogaster (taxid: 7227)
>sp|P46097|SYT2_MOUSE Synaptotagmin-2 OS=Mus musculus GN=Syt2 PE=1 SV=1 Back     alignment and function description
>sp|Q8N9I0|SYT2_HUMAN Synaptotagmin-2 OS=Homo sapiens GN=SYT2 PE=1 SV=2 Back     alignment and function description
>sp|P29101|SYT2_RAT Synaptotagmin-2 OS=Rattus norvegicus GN=Syt2 PE=1 SV=1 Back     alignment and function description
>sp|P41823|SY65_APLCA Synaptotagmin-1 OS=Aplysia californica GN=SYT1 PE=1 SV=2 Back     alignment and function description
>sp|P47191|SYT1_CHICK Synaptotagmin-1 OS=Gallus gallus GN=SYT1 PE=2 SV=1 Back     alignment and function description
>sp|P24506|SY62_DIPOM Synaptotagmin-B OS=Diplobatis ommata GN=P65-B PE=1 SV=1 Back     alignment and function description
>sp|Q5R4J5|SYT1_PONAB Synaptotagmin-1 OS=Pongo abelii GN=SYT1 PE=2 SV=1 Back     alignment and function description
>sp|Q60HC0|SYT1_MACFA Synaptotagmin-1 OS=Macaca fascicularis GN=SYT1 PE=2 SV=1 Back     alignment and function description
>sp|P48018|SYT1_BOVIN Synaptotagmin-1 OS=Bos taurus GN=SYT1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query173
12658419 429 synaptotagmin [Manduca sexta] 0.514 0.207 0.673 8e-29
332018156 436 Synaptotagmin 1 [Acromyrmex echinatior] 0.404 0.160 0.873 1e-28
383860584 434 PREDICTED: synaptotagmin 1-like [Megachi 0.410 0.163 0.859 1e-28
307206115 429 Synaptotagmin [Harpegnathos saltator] 0.410 0.165 0.859 2e-28
193713831 466 PREDICTED: synaptotagmin 1 isoform 1 [Ac 0.410 0.152 0.845 5e-28
288869516 454 synaptotagmin 1 [Nasonia vitripennis] 0.404 0.154 0.857 6e-28
270006365 444 synaptotagmin [Tribolium castaneum] 0.520 0.202 0.666 6e-28
357626340 419 synaptotagmin I [Danaus plexippus] 0.520 0.214 0.666 6e-28
225543472 444 synaptotagmin 1 [Tribolium castaneum] gi 0.520 0.202 0.666 6e-28
237648990 431 synaptotagmin I [Bombyx mori] gi|2237024 0.520 0.208 0.666 9e-28
>gi|12658419|gb|AAK01129.1|AF331039_1 synaptotagmin [Manduca sexta] Back     alignment and taxonomy information
 Score =  131 bits (330), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 73/95 (76%), Gaps = 6/95 (6%)

Query: 77  IANESMKIADKVAEETGMPPWVVVSIFIERQILEGVPYADAMNKTLVFAIFDFDRFSKHD 136
           + ++  K   KV  +T  P      +F E  + + VPYADAMNKTLVFAIFDFDRFSKHD
Sbjct: 198 LPDKKKKFETKVHRKTLSP------VFNETFVFKNVPYADAMNKTLVFAIFDFDRFSKHD 251

Query: 137 QIGEVKVALCQIDLAQTIEEWRELQSVEGEGGQIG 171
           QIGEVKV LCQ+DLAQTIEEWRELQSVEGEGGQ+G
Sbjct: 252 QIGEVKVPLCQVDLAQTIEEWRELQSVEGEGGQLG 286




Source: Manduca sexta

Species: Manduca sexta

Genus: Manduca

Family: Sphingidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332018156|gb|EGI58762.1| Synaptotagmin 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383860584|ref|XP_003705769.1| PREDICTED: synaptotagmin 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307206115|gb|EFN84195.1| Synaptotagmin [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|193713831|ref|XP_001944713.1| PREDICTED: synaptotagmin 1 isoform 1 [Acyrthosiphon pisum] gi|328711543|ref|XP_003244566.1| PREDICTED: synaptotagmin 1 isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|288869516|ref|NP_001165865.1| synaptotagmin 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|270006365|gb|EFA02813.1| synaptotagmin [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357626340|gb|EHJ76466.1| synaptotagmin I [Danaus plexippus] Back     alignment and taxonomy information
>gi|225543472|ref|NP_001139384.1| synaptotagmin 1 [Tribolium castaneum] gi|223702450|gb|ACN21656.1| synaptotagmin I isoform A [Tribolium castaneum] Back     alignment and taxonomy information
>gi|237648990|ref|NP_001153672.1| synaptotagmin I [Bombyx mori] gi|223702452|gb|ACN21657.1| synaptotagmin I isoform A [Bombyx mori] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query173
FB|FBgn0004242 474 Syt1 "Synaptotagmin 1" [Drosop 0.497 0.181 0.678 1.2e-24
UNIPROTKB|Q8N9I0 419 SYT2 "Synaptotagmin-2" [Homo s 0.317 0.131 0.654 7.5e-16
MGI|MGI:99666 422 Syt2 "synaptotagmin II" [Mus m 0.317 0.130 0.654 1.5e-15
UNIPROTKB|P47191 424 SYT1 "Synaptotagmin-1" [Gallus 0.369 0.150 0.553 1.7e-15
RGD|3804 422 Syt2 "synaptotagmin II" [Rattu 0.317 0.130 0.654 2e-15
UNIPROTKB|P29101 422 Syt2 "Synaptotagmin-2" [Rattus 0.317 0.130 0.654 2e-15
UNIPROTKB|F1S5A0 362 SYT2 "Uncharacterized protein" 0.317 0.151 0.654 2.3e-15
ZFIN|ZDB-GENE-060503-315 430 syt2a "synaptotagmin IIa" [Dan 0.317 0.127 0.563 2.4e-15
UNIPROTKB|G5E6N8 417 SYT2 "Uncharacterized protein" 0.317 0.131 0.654 3.1e-15
UNIPROTKB|J3KQA0 419 SYT1 "Synaptotagmin I, isoform 0.369 0.152 0.538 1.9e-14
FB|FBgn0004242 Syt1 "Synaptotagmin 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 285 (105.4 bits), Expect = 1.2e-24, P = 1.2e-24
 Identities = 59/87 (67%), Positives = 67/87 (77%)

Query:    84 IADKVAE-ETGMPPWVVVSIFIERQILEGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVK 142
             + DK  + ET +    +  +F E    + +PYADAMNKTLVFAIFDFDRFSKHDQIGEVK
Sbjct:   237 LPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVK 296

Query:   143 VALCQIDLAQTIEEWRELQSVEGEGGQ 169
             V LC IDLAQTIEEWR+L SVEGEGGQ
Sbjct:   297 VPLCTIDLAQTIEEWRDLVSVEGEGGQ 323




GO:0007269 "neurotransmitter secretion" evidence=NAS;IMP
GO:0016192 "vesicle-mediated transport" evidence=IMP;TAS
GO:0008345 "larval locomotory behavior" evidence=IMP
GO:0030285 "integral to synaptic vesicle membrane" evidence=NAS
GO:0005509 "calcium ion binding" evidence=ISS;IDA
GO:0006887 "exocytosis" evidence=NAS
GO:0005544 "calcium-dependent phospholipid binding" evidence=TAS
GO:0048489 "synaptic vesicle transport" evidence=NAS
GO:0008021 "synaptic vesicle" evidence=ISS;IDA;NAS
GO:0016020 "membrane" evidence=IEA;NAS
GO:0007317 "regulation of pole plasm oskar mRNA localization" evidence=IMP
GO:0016079 "synaptic vesicle exocytosis" evidence=ISS
GO:0005515 "protein binding" evidence=IPI
GO:0031594 "neuromuscular junction" evidence=IDA
GO:0048488 "synaptic vesicle endocytosis" evidence=IDA;IMP
GO:0005215 "transporter activity" evidence=IEA
GO:0050803 "regulation of synapse structure and activity" evidence=IMP
GO:0048791 "calcium ion-dependent exocytosis of neurotransmitter" evidence=IMP
GO:0007268 "synaptic transmission" evidence=IDA
GO:0060024 "rhythmic synaptic transmission" evidence=IDA
UNIPROTKB|Q8N9I0 SYT2 "Synaptotagmin-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:99666 Syt2 "synaptotagmin II" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P47191 SYT1 "Synaptotagmin-1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|3804 Syt2 "synaptotagmin II" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P29101 Syt2 "Synaptotagmin-2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1S5A0 SYT2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-315 syt2a "synaptotagmin IIa" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|G5E6N8 SYT2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J3KQA0 SYT1 "Synaptotagmin I, isoform CRA_b" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P21521SY65_DROMENo assigned EC number0.64510.50280.1835yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
cd08385124 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain 5e-25
cd08386125 cd08386, C2A_Synaptotagmin-7, C2A domain first rep 2e-13
cd08390123 cd08390, C2A_Synaptotagmin-15-17, C2A domain first 2e-08
cd08387124 cd08387, C2A_Synaptotagmin-8, C2A domain first rep 5e-08
cd08388128 cd08388, C2A_Synaptotagmin-4-11, C2A domain first 2e-06
cd00030102 cd00030, C2, C2 domain 7e-05
smart00239101 smart00239, C2, Protein kinase C conserved region 6e-04
cd04029125 cd04029, C2A_SLP-4_5, C2 domain first repeat prese 0.001
>gnl|CDD|176031 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
 Score = 93.1 bits (232), Expect = 5e-25
 Identities = 32/51 (62%), Positives = 41/51 (80%)

Query: 112 VPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQS 162
           VPY++  NKTLVF+++DFDRFSKHD IGEV+V L  +DL    EEWR+L+S
Sbjct: 74  VPYSELGNKTLVFSVYDFDRFSKHDLIGEVRVPLLTVDLGHVTEEWRDLES 124


Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 1, a member of class 1 synaptotagmins, is located in the brain and endocranium and localized to the synaptic vesicles and secretory granules. It functions as a Ca2+ sensor for fast exocytosis as do synaptotagmins 5, 6, and 10. It is distinguished from the other synaptotagmins by having an N-glycosylated N-terminus. Synaptotagmins 5, 6, and 10, members of class 3 synaptotagmins, are located primarily in the brain and localized to the active zone and plasma membrane. They is distinguished from the other synaptotagmins by having disulfide bonds at its N-terminus. Synaptotagmin 6 also regulates the acrosome reaction, a unique Ca2+-regulated exocytosis, in sperm. Synaptotagmin 9, a class 5 synaptotagmins, is located in the brain and localized to the synaptic vesicles. It is thought to be a Ca2+-sensor for dense-core vesicle exocytosis. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium. Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10). The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B). C2B also regulates also the recycling step of synaptic vesicles. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. C2 domains with a calcium binding region have negatively charged residues, primarily aspartates, that serve as ligands for calcium ions. This cd contains the first C2 repeat, C2A, and has a type-I topology. Length = 124

>gnl|CDD|176032 cd08386, C2A_Synaptotagmin-7, C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|176036 cd08390, C2A_Synaptotagmin-15-17, C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>gnl|CDD|176033 cd08387, C2A_Synaptotagmin-8, C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>gnl|CDD|176034 cd08388, C2A_Synaptotagmin-4-11, C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>gnl|CDD|175973 cd00030, C2, C2 domain Back     alignment and domain information
>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>gnl|CDD|175995 cd04029, C2A_SLP-4_5, C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 173
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 99.94
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 99.9
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 99.89
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 99.88
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 99.88
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 99.88
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 99.88
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 99.88
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 99.87
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 99.86
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 99.86
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 99.86
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 99.85
KOG1028|consensus421 99.85
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 99.84
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 99.84
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 99.83
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 99.83
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 99.83
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 99.82
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 99.82
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 99.81
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 99.81
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 99.81
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 99.8
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 99.8
KOG1028|consensus 421 99.79
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 99.79
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 99.78
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 99.78
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 99.78
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 99.78
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 99.77
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 99.77
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 99.76
cd04010148 C2B_RasA3 C2 domain second repeat present in RAS p 99.76
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 99.75
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 99.73
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 99.73
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 99.72
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 99.72
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 99.72
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 99.71
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 99.71
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 99.7
cd08378121 C2B_MCTP_PRT_plant C2 domain second repeat found i 99.7
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 99.69
cd08690155 C2_Freud-1 C2 domain found in 5' repressor element 99.69
KOG0905|consensus1639 99.68
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 99.68
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 99.68
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 99.67
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 99.67
cd08373127 C2A_Ferlin C2 domain first repeat in Ferlin. Ferli 99.66
cd08675137 C2B_RasGAP C2 domain second repeat of Ras GTPase a 99.65
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 99.65
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 99.65
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 99.64
cd08394127 C2A_Munc13 C2 domain first repeat in Munc13 (mamma 99.64
cd04019150 C2C_MCTP_PRT_plant C2 domain third repeat found in 99.64
KOG1030|consensus168 99.64
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 99.63
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 99.63
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 99.63
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 99.63
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 99.63
KOG0696|consensus 683 99.62
cd08391121 C2A_C2C_Synaptotagmin_like C2 domain first and thi 99.62
cd08382123 C2_Smurf-like C2 domain present in Smad ubiquitina 99.62
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 99.61
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 99.6
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 99.6
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 99.59
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 99.59
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 99.58
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 99.58
cd04049124 C2_putative_Elicitor-responsive_gene C2 domain pre 99.58
cd04052111 C2B_Tricalbin-like C2 domain second repeat present 99.57
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 99.55
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 99.55
cd04051125 C2_SRC2_like C2 domain present in Soybean genes Re 99.53
cd08691137 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li 99.53
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 99.51
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 99.51
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 99.5
cd08686118 C2_ABR C2 domain in the Active BCR (Breakpoint clu 99.5
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 99.5
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 99.5
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 99.47
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 99.46
cd04038145 C2_ArfGAP C2 domain present in Arf GTPase Activati 99.45
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 99.45
cd04037124 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli 99.44
cd08374133 C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli 99.43
PLN03008 868 Phospholipase D delta 99.41
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 99.34
cd00275128 C2_PLC_like C2 domain present in Phosphoinositide- 99.32
PLN032002102 cellulose synthase-interactive protein; Provisiona 99.24
PLN02223537 phosphoinositide phospholipase C 99.2
PLN02952599 phosphoinositide phospholipase C 99.18
PF0016885 C2: C2 domain; InterPro: IPR000008 The C2 domain i 99.16
KOG2059|consensus 800 99.15
cd00030102 C2 C2 domain. The C2 domain was first identified i 99.11
KOG1013|consensus362 99.09
smart00239101 C2 Protein kinase C conserved region 2 (CalB). Ca2 99.08
PLN02230598 phosphoinositide phospholipase C 4 99.06
KOG1011|consensus 1283 99.04
PLN02222581 phosphoinositide phospholipase C 2 99.02
KOG2059|consensus 800 98.97
KOG1328|consensus 1103 98.93
COG50381227 Ca2+-dependent lipid-binding protein, contains C2 98.89
PLN02228567 Phosphoinositide phospholipase C 98.89
KOG0169|consensus746 98.88
KOG1328|consensus1103 98.86
KOG1264|consensus1267 98.67
cd08684103 C2A_Tac2-N C2 domain first repeat found in Tac2-N 98.59
KOG1013|consensus 362 98.55
COG5038 1227 Ca2+-dependent lipid-binding protein, contains C2 98.4
KOG1031|consensus 1169 98.4
PLN02270 808 phospholipase D alpha 98.36
KOG1011|consensus1283 98.36
cd08683143 C2_C2cd3 C2 domain found in C2 calcium-dependent d 98.24
cd08689109 C2_fungal_Pkc1p C2 domain found in protein kinase 98.01
KOG2060|consensus405 97.98
PLN02964 644 phosphatidylserine decarboxylase 97.65
PLN02352 758 phospholipase D epsilon 97.53
KOG1326|consensus 1105 97.46
KOG1327|consensus 529 97.32
cd08397159 C2_PI3K_class_III C2 domain present in class III p 96.53
KOG1265|consensus 1189 96.14
PF00792142 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I 95.98
cd08380156 C2_PI3K_like C2 domain present in phosphatidylinos 95.95
KOG1326|consensus 1105 95.83
KOG3837|consensus523 95.46
PF14429184 DOCK-C2: C2 domain in Dock180 and Zizimin proteins 95.28
cd08398158 C2_PI3K_class_I_alpha C2 domain present in class I 95.26
cd08693173 C2_PI3K_class_I_beta_delta C2 domain present in cl 95.21
cd08694196 C2_Dock-A C2 domains found in Dedicator Of CytoKin 95.11
cd08695189 C2_Dock-B C2 domains found in Dedicator Of CytoKin 94.18
PF15627156 CEP76-C2: CEP76 C2 domain 94.07
cd08399178 C2_PI3K_class_I_gamma C2 domain present in class I 93.0
cd04012171 C2A_PI3K_class_II C2 domain first repeat present i 92.67
cd08679178 C2_DOCK180_related C2 domains found in Dedicator O 92.54
PF12416 340 DUF3668: Cep120 protein; InterPro: IPR022136 This 91.02
cd08696179 C2_Dock-C C2 domains found in Dedicator Of CytoKin 90.75
cd08697185 C2_Dock-D C2 domains found in Dedicator Of CytoKin 90.48
KOG1327|consensus 529 87.08
smart00142100 PI3K_C2 Phosphoinositide 3-kinase, region postulat 86.95
PF10358143 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; 82.99
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
Probab=99.94  E-value=1.9e-26  Score=170.93  Aligned_cols=109  Identities=17%  Similarity=0.364  Sum_probs=97.1

Q ss_pred             cceecchheecccccceeeEEeeec----cCCCccEEEe-----cCeEEeecccCCCCCCeeecEEEecccCcccCCCCE
Q psy12096         51 EDLEMTEAFEDVSEELSSTVASIKK----EIANESMKIA-----DKVAEETGMPPWVVVSIFIERQILEGVPYADAMNKT  121 (173)
Q Consensus        51 ~~l~~~~~~~~~~~~l~~lv~~ik~----~~~dPyVkv~-----~~~k~kTkv~kktlnP~wnEtf~F~gV~~~~l~~~~  121 (173)
                      ++|++++.|.....+|.+.++.++.    +.+|||||++     ++.+++|+++++|+||+|||+|.|. |+.+++.+.+
T Consensus         1 ~~l~fsL~Y~~~~~~L~V~vikA~~L~~~g~sDPYVKv~L~~~~k~~k~kT~v~rktlnPvfnE~f~F~-v~~~~l~~~t   79 (118)
T cd08677           1 PKLHYSLSYDKQKAELHVNILEAENISVDAGCECYISGCVSVSEGQKEAQTALKKLALHTQWEEELVFP-LPEEESLDGT   79 (118)
T ss_pred             CeEEEEEEEcCcCCEEEEEEEEecCCCCCCCCCeEEEEEEcCCcCccEEEcceecCCCCCccccEEEEe-CCHHHhCCcE
Confidence            4689999999999999877765532    3479999998     3358899999999999999999999 9999999999


Q ss_pred             EEEEEEEcCCCCCCceeEEEEEeCCccccccccceeEeC
Q psy12096        122 LVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWREL  160 (173)
Q Consensus       122 L~~~V~D~d~~~~~d~IG~v~l~L~~l~~~~~~~~W~~L  160 (173)
                      |.|+|||+|++++|++||++.++|++++...+..+|.+|
T Consensus        80 L~~~V~d~Drfs~~d~IG~v~l~l~~~~~~~~~~~W~~~  118 (118)
T cd08677          80 LTLTLRCCDRFSRHSTLGELRLKLADVSMMLGAAQWVDL  118 (118)
T ss_pred             EEEEEEeCCCCCCCceEEEEEEccccccCCccccchhcC
Confidence            999999999999999999999999998777788999876



Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 13, a member of class 6 synaptotagmins, is located in the brain. It functions are unknown. It, like synaptotagmins 8 and 12, does not have any consensus Ca2+ binding sites. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium. Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10). The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B). C2B also regulates also the recycling step of synaptic vesicles. C2 domain

>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>KOG1028|consensus Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>KOG1028|consensus Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>KOG0905|consensus Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin Back     alignment and domain information
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>KOG1030|consensus Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin Back     alignment and domain information
>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PLN02223 phosphoinositide phospholipase C Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking Back     alignment and domain information
>KOG2059|consensus Back     alignment and domain information
>cd00030 C2 C2 domain Back     alignment and domain information
>KOG1013|consensus Back     alignment and domain information
>smart00239 C2 Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information
>KOG1011|consensus Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>KOG2059|consensus Back     alignment and domain information
>KOG1328|consensus Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>KOG0169|consensus Back     alignment and domain information
>KOG1328|consensus Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>KOG1013|consensus Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>KOG1031|consensus Back     alignment and domain information
>PLN02270 phospholipase D alpha Back     alignment and domain information
>KOG1011|consensus Back     alignment and domain information
>cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins Back     alignment and domain information
>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae Back     alignment and domain information
>KOG2060|consensus Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>PLN02352 phospholipase D epsilon Back     alignment and domain information
>KOG1326|consensus Back     alignment and domain information
>KOG1327|consensus Back     alignment and domain information
>cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>KOG1265|consensus Back     alignment and domain information
>PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2 Back     alignment and domain information
>cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>KOG1326|consensus Back     alignment and domain information
>KOG3837|consensus Back     alignment and domain information
>PF14429 DOCK-C2: C2 domain in Dock180 and Zizimin proteins; PDB: 3L4C_A Back     alignment and domain information
>cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08694 C2_Dock-A C2 domains found in Dedicator Of CytoKinesis (Dock) class A proteins Back     alignment and domain information
>cd08695 C2_Dock-B C2 domains found in Dedicator Of CytoKinesis (Dock) class B proteins Back     alignment and domain information
>PF15627 CEP76-C2: CEP76 C2 domain Back     alignment and domain information
>cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08679 C2_DOCK180_related C2 domains found in Dedicator Of CytoKinesis 1 (DOCK 180) and related proteins Back     alignment and domain information
>PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length Back     alignment and domain information
>cd08696 C2_Dock-C C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins Back     alignment and domain information
>cd08697 C2_Dock-D C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins Back     alignment and domain information
>KOG1327|consensus Back     alignment and domain information
>smart00142 PI3K_C2 Phosphoinositide 3-kinase, region postulated to contain C2 domain Back     alignment and domain information
>PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
2r83_A 284 Crystal Structure Analysis Of Human Synaptotagmin 1 4e-14
1byn_A128 Solution Structure Of The Calcium-Bound First C2-Do 1e-13
1rsy_A152 Structure Of The First C2-domain Of Synaptotagmin I 1e-13
3f00_A143 Crystal Structure Of Synaptotagmin I C2a Domain Wit 3e-13
3f04_A143 Crystal Structure Of Synaptotagmin I C2a Domain Len 3e-13
2d8k_A141 Solution Structure Of The First C2 Domain Of Synapt 2e-09
2enp_A147 Solution Structure Of The First C2 Domain From Huma 3e-09
1ugk_A138 Solution Structure Of The First C2 Domain Of Synapt 9e-05
1dqv_A 296 Crystal Structure Of Synaptotagmin Iii C2aC2B Lengt 1e-04
3hn8_A 296 Crystal Structure Of Synaptotagmin Length = 296 1e-04
>pdb|2R83|A Chain A, Crystal Structure Analysis Of Human Synaptotagmin 1 C2a-c2b Length = 284 Back     alignment and structure

Iteration: 1

Score = 73.9 bits (180), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 32/55 (58%), Positives = 39/55 (70%) Query: 112 VPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQSVEGE 166 VPY++ KTLV A++DFDRFSKHD IGE KV + +D EEWR+LQS E E Sbjct: 77 VPYSELAGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKE 131
>pdb|1BYN|A Chain A, Solution Structure Of The Calcium-Bound First C2-Domain Of Synaptotagmin I Length = 128 Back     alignment and structure
>pdb|1RSY|A Chain A, Structure Of The First C2-domain Of Synaptotagmin I: A Novel Ca2+(slash)phospholipid Binding Fold Length = 152 Back     alignment and structure
>pdb|3F00|A Chain A, Crystal Structure Of Synaptotagmin I C2a Domain With Cu(Ii) Length = 143 Back     alignment and structure
>pdb|3F04|A Chain A, Crystal Structure Of Synaptotagmin I C2a Domain Length = 143 Back     alignment and structure
>pdb|2D8K|A Chain A, Solution Structure Of The First C2 Domain Of Synaptotagmin Vii Length = 141 Back     alignment and structure
>pdb|2ENP|A Chain A, Solution Structure Of The First C2 Domain From Human BK Protein Length = 147 Back     alignment and structure
>pdb|1UGK|A Chain A, Solution Structure Of The First C2 Domain Of Synaptotagmin Iv From Human Fetal Brain (Kiaa1342) Length = 138 Back     alignment and structure
>pdb|1DQV|A Chain A, Crystal Structure Of Synaptotagmin Iii C2aC2B Length = 296 Back     alignment and structure
>pdb|3HN8|A Chain A, Crystal Structure Of Synaptotagmin Length = 296 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 5e-18
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 6e-17
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 8e-17
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 8e-17
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 9e-17
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 3e-16
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 4e-16
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 5e-16
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 1e-15
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 2e-15
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 4e-14
2r83_A 284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 2e-12
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 4e-12
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 2e-11
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 2e-11
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 3e-11
1dqv_A 296 Synaptotagmin III; beta sandwich, calcium ION, C2 3e-11
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 5e-11
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 3e-10
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 3e-10
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 2e-09
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 6e-09
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 1e-07
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 1e-06
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 2e-06
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 2e-06
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 4e-06
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 7e-06
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 5e-05
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 3e-04
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 7e-04
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
 Score = 75.1 bits (185), Expect = 5e-18
 Identities = 14/57 (24%), Positives = 25/57 (43%)

Query: 112 VPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQSVEGEGG 168
           +   +    TL   +   DRFS+H   GE+++ L    +     +W EL++     G
Sbjct: 82  LAEEELPTATLTLTLRTCDRFSRHSVAGELRLGLDGTSVPLGAAQWGELKTSGPSSG 138


>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Length = 134 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 142 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 141 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Length = 129 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Length = 166 Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138 Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Length = 153 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query173
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 99.91
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 99.88
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 99.87
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 99.86
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 99.86
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 99.86
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 99.85
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 99.85
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 99.84
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 99.83
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 99.83
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 99.83
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 99.82
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 99.82
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 99.82
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 99.82
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 99.81
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 99.81
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 99.81
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 99.8
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 99.8
2r83_A 284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 99.8
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 99.79
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 99.77
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 99.77
1dqv_A 296 Synaptotagmin III; beta sandwich, calcium ION, C2 99.75
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 99.75
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 99.74
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 99.72
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 99.72
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 99.71
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 99.71
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 99.71
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 99.7
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 99.7
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 99.68
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 99.68
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 99.6
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 99.54
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 99.5
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 99.46
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 99.43
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 99.41
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.37
3nsj_A540 Perforin-1; pore forming protein, immune system; H 99.37
3bxj_A 483 RAS GTPase-activating protein syngap; GTPase activ 99.32
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 99.03
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 99.02
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.0
1yrk_A126 NPKC-delta, protein kinase C, delta type; C2 domai 98.72
2enj_A138 NPKC-theta, protein kinase C theta type; beta-sand 98.63
3l4c_A220 Dedicator of cytokinesis protein 1; DOCK180, DOCK1 95.57
2wxf_A 940 Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca 88.79
1e7u_A 961 Phosphatidylinositol 3-kinase catalytic subunit; p 86.08
3hhm_A 1091 Phosphatidylinositol-4,5-bisphosphate 3-kinase cat 82.89
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
Probab=99.91  E-value=1.3e-23  Score=156.72  Aligned_cols=121  Identities=17%  Similarity=0.230  Sum_probs=104.3

Q ss_pred             CCCcccceecchheecccccceeeEEeeec----cCCCccEEEe-----cCeEEeecccCCCCCCeeecEEEecccCccc
Q psy12096         46 PEDEEEDLEMTEAFEDVSEELSSTVASIKK----EIANESMKIA-----DKVAEETGMPPWVVVSIFIERQILEGVPYAD  116 (173)
Q Consensus        46 ~~~~~~~l~~~~~~~~~~~~l~~lv~~ik~----~~~dPyVkv~-----~~~k~kTkv~kktlnP~wnEtf~F~gV~~~~  116 (173)
                      .....|+|++++.|.....+|.+.|+..+.    +..||||+++     .+.++||+++++|+||+|||+|.|. ++..+
T Consensus         8 s~~~~G~l~~sl~y~~~~~~L~V~v~~a~~~d~~g~sDPyv~v~l~~~~~~~~~kT~v~~~tlnP~wnE~f~f~-v~~~~   86 (138)
T 1wfm_A            8 SWNQAPKLHYCLDYDCQKAELFVTRLEAVTSNHDGGCDCYVQGSVANRTGSVEAQTALKKRQLHTTWEEGLVLP-LAEEE   86 (138)
T ss_dssp             CCSSCCEEEEEEEEETTTTEEEEEEEEEECCCCSSCCCEEEEEEEEETTEEEEEECCCCCCCSSEECSSCEEEE-CCTTS
T ss_pred             CCCcceEEEEEEEEeCCCCEEEEEEEEEEcCCCCCCcceEEEEEEEcCCCcccEecccCcCCCCCcCCceEEEE-ecHHH
Confidence            345569999999999988888877776653    3479999998     1236899999999999999999999 99888


Q ss_pred             CCCCEEEEEEEEcCCCCCCceeEEEEEeCCccccccccceeEeCccCCccc
Q psy12096        117 AMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQSVEGEG  167 (173)
Q Consensus       117 l~~~~L~~~V~D~d~~~~~d~IG~v~l~L~~l~~~~~~~~W~~L~p~~~~~  167 (173)
                      +....|.|.|||+|+++++++||++.++|.++.......+|++|++..+++
T Consensus        87 l~~~~L~~~V~d~d~~~~dd~lG~~~i~l~~l~~~~~~~~W~~L~~~~~~~  137 (138)
T 1wfm_A           87 LPTATLTLTLRTCDRFSRHSVAGELRLGLDGTSVPLGAAQWGELKTSGPSS  137 (138)
T ss_dssp             STTCEEEEEEEECCSSCTTSCSEEEEEESSSSSSCTTCCEEEECCCCSCCC
T ss_pred             cCCCEEEEEEEECCCCCCCcEEEEEEEEcccccCcccccceeeCcCCCcCC
Confidence            877899999999999999999999999999998777778999999976654



>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A Back     alignment and structure
>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3l4c_A Dedicator of cytokinesis protein 1; DOCK180, DOCK1, phosphoinositide specificity, guanine exchan factor, RHO GTPase, cytoskeleton, cell migration; 2.37A {Homo sapiens} Back     alignment and structure
>2wxf_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit delta isoform; transferase, phosphoprotein, isoform-specific inhibitors; HET: 039; 1.90A {Mus musculus} PDB: 2wxg_A* 2wxh_A* 2wxi_A* 2wxj_A* 2wxk_A* 2wxl_A* 2wxm_A* 2wxn_A* 2wxo_A* 2wxp_A* 2wxq_A* 2wxr_A 2x38_A* Back     alignment and structure
>3hhm_A Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_A 2rd0_A 4a55_A* 2enq_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 173
d1rsya_143 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 2e-10
d1ugka_138 b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens 2e-09
d1rh8a_142 b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax 2e-07
d2bwqa1125 b.7.1.2 (A:729-853) Regulating synaptic membrane e 3e-07
d1wfma_138 b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapie 4e-07
d1a25a_132 b.7.1.2 (A:) C2 domain from protein kinase c (beta 5e-07
d1dqva1130 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus 1e-06
d1dqva2145 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus 1e-05
d1w15a_138 b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi 2e-05
d1uowa_157 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 1e-04
d1wfja_136 b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr 2e-04
d1rlwa_126 b.7.1.1 (A:) Domain from cytosolic phospholipase A 2e-04
d2cm5a1137 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( 5e-04
d2ep6a1126 b.7.1.1 (A:92-217) Multiple C2 and transmembrane d 0.001
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 Back     information, alignment and structure

class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: Synaptotagmin-like (S variant)
domain: Synaptogamin I
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score = 54.0 bits (129), Expect = 2e-10
 Identities = 30/51 (58%), Positives = 37/51 (72%)

Query: 112 VPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQS 162
           VPY++   KTLV A++DFDRFSKHD IGE KV +  +D     EEWR+LQS
Sbjct: 92  VPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQS 142


>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 130 Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 Back     information, alignment and structure
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query173
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 99.88
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.88
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 99.84
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 99.84
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.83
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.82
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 99.82
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 99.82
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 99.82
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 99.81
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.79
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 99.72
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 99.7
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 99.65
d2cjta1128 Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 99.65
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 99.62
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 99.61
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 99.55
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 99.52
d2zkmx2122 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.29
d1e7ua2174 Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) 94.33
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: Synaptotagmin-like (S variant)
domain: Synaptotagmin XIII
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.88  E-value=1.9e-22  Score=149.10  Aligned_cols=118  Identities=18%  Similarity=0.234  Sum_probs=103.1

Q ss_pred             CCcccceecchheecccccceeeEEeee----ccCCCccEEEe-----cCeEEeecccCCCCCCeeecEEEecccCcccC
Q psy12096         47 EDEEEDLEMTEAFEDVSEELSSTVASIK----KEIANESMKIA-----DKVAEETGMPPWVVVSIFIERQILEGVPYADA  117 (173)
Q Consensus        47 ~~~~~~l~~~~~~~~~~~~l~~lv~~ik----~~~~dPyVkv~-----~~~k~kTkv~kktlnP~wnEtf~F~gV~~~~l  117 (173)
                      ..+..+|++++.|....++|.+.|+..+    .+..||||+++     ...++||++++++.||.|||+|.|. |+..++
T Consensus         9 ~~~~~~l~~sl~y~~~~~~L~V~v~~a~~L~~~g~~dpyVkv~l~~~~~~~~~kT~v~~~~~~P~wne~f~f~-v~~~~l   87 (138)
T d1wfma_           9 WNQAPKLHYCLDYDCQKAELFVTRLEAVTSNHDGGCDCYVQGSVANRTGSVEAQTALKKRQLHTTWEEGLVLP-LAEEEL   87 (138)
T ss_dssp             CSSCCEEEEEEEEETTTTEEEEEEEEEECCCCSSCCCEEEEEEEEETTEEEEEECCCCCCCSSEECSSCEEEE-CCTTSS
T ss_pred             CCcCCEEEEEEEECCCCCEEEEEEEEcCCCCCCCCcCcEEEEEECCCCCccceeeeEECCCCCceEeeeEEEE-eeehhc
Confidence            5667899999999999888887776654    24569999998     2236889999999999999999999 998888


Q ss_pred             CCCEEEEEEEEcCCCCCCceeEEEEEeCCccccccccceeEeCccCCc
Q psy12096        118 MNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQSVEG  165 (173)
Q Consensus       118 ~~~~L~~~V~D~d~~~~~d~IG~v~l~L~~l~~~~~~~~W~~L~p~~~  165 (173)
                      ....|.|+|||+++++++++||++.|+|.++......+.|++|++...
T Consensus        88 ~~~~L~~~V~d~~~~~~~~~iG~~~i~L~~l~~~~~~~~W~~L~~~~~  135 (138)
T d1wfma_          88 PTATLTLTLRTCDRFSRHSVAGELRLGLDGTSVPLGAAQWGELKTSGP  135 (138)
T ss_dssp             TTCEEEEEEEECCSSCTTSCSEEEEEESSSSSSCTTCCEEEECCCCSC
T ss_pred             cceEEEEEEeeecccccceeeeEEEEEhHHccCCCCceEeEeCCCCCC
Confidence            888999999999999999999999999999987778899999988654



>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure