Psyllid ID: psy12096
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 173 | ||||||
| 12658419 | 429 | synaptotagmin [Manduca sexta] | 0.514 | 0.207 | 0.673 | 8e-29 | |
| 332018156 | 436 | Synaptotagmin 1 [Acromyrmex echinatior] | 0.404 | 0.160 | 0.873 | 1e-28 | |
| 383860584 | 434 | PREDICTED: synaptotagmin 1-like [Megachi | 0.410 | 0.163 | 0.859 | 1e-28 | |
| 307206115 | 429 | Synaptotagmin [Harpegnathos saltator] | 0.410 | 0.165 | 0.859 | 2e-28 | |
| 193713831 | 466 | PREDICTED: synaptotagmin 1 isoform 1 [Ac | 0.410 | 0.152 | 0.845 | 5e-28 | |
| 288869516 | 454 | synaptotagmin 1 [Nasonia vitripennis] | 0.404 | 0.154 | 0.857 | 6e-28 | |
| 270006365 | 444 | synaptotagmin [Tribolium castaneum] | 0.520 | 0.202 | 0.666 | 6e-28 | |
| 357626340 | 419 | synaptotagmin I [Danaus plexippus] | 0.520 | 0.214 | 0.666 | 6e-28 | |
| 225543472 | 444 | synaptotagmin 1 [Tribolium castaneum] gi | 0.520 | 0.202 | 0.666 | 6e-28 | |
| 237648990 | 431 | synaptotagmin I [Bombyx mori] gi|2237024 | 0.520 | 0.208 | 0.666 | 9e-28 |
| >gi|12658419|gb|AAK01129.1|AF331039_1 synaptotagmin [Manduca sexta] | Back alignment and taxonomy information |
|---|
Score = 131 bits (330), Expect = 8e-29, Method: Compositional matrix adjust.
Identities = 64/95 (67%), Positives = 73/95 (76%), Gaps = 6/95 (6%)
Query: 77 IANESMKIADKVAEETGMPPWVVVSIFIERQILEGVPYADAMNKTLVFAIFDFDRFSKHD 136
+ ++ K KV +T P +F E + + VPYADAMNKTLVFAIFDFDRFSKHD
Sbjct: 198 LPDKKKKFETKVHRKTLSP------VFNETFVFKNVPYADAMNKTLVFAIFDFDRFSKHD 251
Query: 137 QIGEVKVALCQIDLAQTIEEWRELQSVEGEGGQIG 171
QIGEVKV LCQ+DLAQTIEEWRELQSVEGEGGQ+G
Sbjct: 252 QIGEVKVPLCQVDLAQTIEEWRELQSVEGEGGQLG 286
|
Source: Manduca sexta Species: Manduca sexta Genus: Manduca Family: Sphingidae Order: Lepidoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|332018156|gb|EGI58762.1| Synaptotagmin 1 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|383860584|ref|XP_003705769.1| PREDICTED: synaptotagmin 1-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|307206115|gb|EFN84195.1| Synaptotagmin [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|193713831|ref|XP_001944713.1| PREDICTED: synaptotagmin 1 isoform 1 [Acyrthosiphon pisum] gi|328711543|ref|XP_003244566.1| PREDICTED: synaptotagmin 1 isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|288869516|ref|NP_001165865.1| synaptotagmin 1 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|270006365|gb|EFA02813.1| synaptotagmin [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|357626340|gb|EHJ76466.1| synaptotagmin I [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|225543472|ref|NP_001139384.1| synaptotagmin 1 [Tribolium castaneum] gi|223702450|gb|ACN21656.1| synaptotagmin I isoform A [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|237648990|ref|NP_001153672.1| synaptotagmin I [Bombyx mori] gi|223702452|gb|ACN21657.1| synaptotagmin I isoform A [Bombyx mori] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 173 | ||||||
| FB|FBgn0004242 | 474 | Syt1 "Synaptotagmin 1" [Drosop | 0.497 | 0.181 | 0.678 | 1.2e-24 | |
| UNIPROTKB|Q8N9I0 | 419 | SYT2 "Synaptotagmin-2" [Homo s | 0.317 | 0.131 | 0.654 | 7.5e-16 | |
| MGI|MGI:99666 | 422 | Syt2 "synaptotagmin II" [Mus m | 0.317 | 0.130 | 0.654 | 1.5e-15 | |
| UNIPROTKB|P47191 | 424 | SYT1 "Synaptotagmin-1" [Gallus | 0.369 | 0.150 | 0.553 | 1.7e-15 | |
| RGD|3804 | 422 | Syt2 "synaptotagmin II" [Rattu | 0.317 | 0.130 | 0.654 | 2e-15 | |
| UNIPROTKB|P29101 | 422 | Syt2 "Synaptotagmin-2" [Rattus | 0.317 | 0.130 | 0.654 | 2e-15 | |
| UNIPROTKB|F1S5A0 | 362 | SYT2 "Uncharacterized protein" | 0.317 | 0.151 | 0.654 | 2.3e-15 | |
| ZFIN|ZDB-GENE-060503-315 | 430 | syt2a "synaptotagmin IIa" [Dan | 0.317 | 0.127 | 0.563 | 2.4e-15 | |
| UNIPROTKB|G5E6N8 | 417 | SYT2 "Uncharacterized protein" | 0.317 | 0.131 | 0.654 | 3.1e-15 | |
| UNIPROTKB|J3KQA0 | 419 | SYT1 "Synaptotagmin I, isoform | 0.369 | 0.152 | 0.538 | 1.9e-14 |
| FB|FBgn0004242 Syt1 "Synaptotagmin 1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 285 (105.4 bits), Expect = 1.2e-24, P = 1.2e-24
Identities = 59/87 (67%), Positives = 67/87 (77%)
Query: 84 IADKVAE-ETGMPPWVVVSIFIERQILEGVPYADAMNKTLVFAIFDFDRFSKHDQIGEVK 142
+ DK + ET + + +F E + +PYADAMNKTLVFAIFDFDRFSKHDQIGEVK
Sbjct: 237 LPDKKKKFETKVHRKTLSPVFNETFTFKSLPYADAMNKTLVFAIFDFDRFSKHDQIGEVK 296
Query: 143 VALCQIDLAQTIEEWRELQSVEGEGGQ 169
V LC IDLAQTIEEWR+L SVEGEGGQ
Sbjct: 297 VPLCTIDLAQTIEEWRDLVSVEGEGGQ 323
|
|
| UNIPROTKB|Q8N9I0 SYT2 "Synaptotagmin-2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:99666 Syt2 "synaptotagmin II" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P47191 SYT1 "Synaptotagmin-1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|3804 Syt2 "synaptotagmin II" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P29101 Syt2 "Synaptotagmin-2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S5A0 SYT2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060503-315 syt2a "synaptotagmin IIa" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G5E6N8 SYT2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3KQA0 SYT1 "Synaptotagmin I, isoform CRA_b" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 173 | |||
| cd08385 | 124 | cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain | 5e-25 | |
| cd08386 | 125 | cd08386, C2A_Synaptotagmin-7, C2A domain first rep | 2e-13 | |
| cd08390 | 123 | cd08390, C2A_Synaptotagmin-15-17, C2A domain first | 2e-08 | |
| cd08387 | 124 | cd08387, C2A_Synaptotagmin-8, C2A domain first rep | 5e-08 | |
| cd08388 | 128 | cd08388, C2A_Synaptotagmin-4-11, C2A domain first | 2e-06 | |
| cd00030 | 102 | cd00030, C2, C2 domain | 7e-05 | |
| smart00239 | 101 | smart00239, C2, Protein kinase C conserved region | 6e-04 | |
| cd04029 | 125 | cd04029, C2A_SLP-4_5, C2 domain first repeat prese | 0.001 |
| >gnl|CDD|176031 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
Score = 93.1 bits (232), Expect = 5e-25
Identities = 32/51 (62%), Positives = 41/51 (80%)
Query: 112 VPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQS 162
VPY++ NKTLVF+++DFDRFSKHD IGEV+V L +DL EEWR+L+S
Sbjct: 74 VPYSELGNKTLVFSVYDFDRFSKHDLIGEVRVPLLTVDLGHVTEEWRDLES 124
|
Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 1, a member of class 1 synaptotagmins, is located in the brain and endocranium and localized to the synaptic vesicles and secretory granules. It functions as a Ca2+ sensor for fast exocytosis as do synaptotagmins 5, 6, and 10. It is distinguished from the other synaptotagmins by having an N-glycosylated N-terminus. Synaptotagmins 5, 6, and 10, members of class 3 synaptotagmins, are located primarily in the brain and localized to the active zone and plasma membrane. They is distinguished from the other synaptotagmins by having disulfide bonds at its N-terminus. Synaptotagmin 6 also regulates the acrosome reaction, a unique Ca2+-regulated exocytosis, in sperm. Synaptotagmin 9, a class 5 synaptotagmins, is located in the brain and localized to the synaptic vesicles. It is thought to be a Ca2+-sensor for dense-core vesicle exocytosis. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium. Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10). The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B). C2B also regulates also the recycling step of synaptic vesicles. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. C2 domains with a calcium binding region have negatively charged residues, primarily aspartates, that serve as ligands for calcium ions. This cd contains the first C2 repeat, C2A, and has a type-I topology. Length = 124 |
| >gnl|CDD|176032 cd08386, C2A_Synaptotagmin-7, C2A domain first repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >gnl|CDD|176036 cd08390, C2A_Synaptotagmin-15-17, C2A domain first repeat present in Synaptotagmins 15 and 17 | Back alignment and domain information |
|---|
| >gnl|CDD|176033 cd08387, C2A_Synaptotagmin-8, C2A domain first repeat present in Synaptotagmin 8 | Back alignment and domain information |
|---|
| >gnl|CDD|176034 cd08388, C2A_Synaptotagmin-4-11, C2A domain first repeat present in Synaptotagmins 4 and 11 | Back alignment and domain information |
|---|
| >gnl|CDD|175973 cd00030, C2, C2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) | Back alignment and domain information |
|---|
| >gnl|CDD|175995 cd04029, C2A_SLP-4_5, C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 173 | |||
| cd08677 | 118 | C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a | 99.94 | |
| cd08393 | 125 | C2A_SLP-1_2 C2 domain first repeat present in Syna | 99.9 | |
| cd04029 | 125 | C2A_SLP-4_5 C2 domain first repeat present in Syna | 99.89 | |
| cd04028 | 146 | C2B_RIM1alpha C2 domain second repeat contained in | 99.88 | |
| cd08680 | 124 | C2_Kibra C2 domain found in Human protein Kibra. K | 99.88 | |
| cd08389 | 124 | C2A_Synaptotagmin-14_16 C2A domain first repeat pr | 99.88 | |
| cd08381 | 122 | C2B_PI3K_class_II C2 domain second repeat present | 99.88 | |
| cd08392 | 128 | C2A_SLP-3 C2 domain first repeat present in Synapt | 99.88 | |
| cd08407 | 138 | C2B_Synaptotagmin-13 C2 domain second repeat prese | 99.87 | |
| cd08388 | 128 | C2A_Synaptotagmin-4-11 C2A domain first repeat pre | 99.86 | |
| cd08385 | 124 | C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe | 99.86 | |
| cd08387 | 124 | C2A_Synaptotagmin-8 C2A domain first repeat presen | 99.86 | |
| cd08406 | 136 | C2B_Synaptotagmin-12 C2 domain second repeat prese | 99.85 | |
| KOG1028|consensus | 421 | 99.85 | ||
| cd08386 | 125 | C2A_Synaptotagmin-7 C2A domain first repeat presen | 99.84 | |
| cd04030 | 127 | C2C_KIAA1228 C2 domain third repeat present in unc | 99.84 | |
| cd08521 | 123 | C2A_SLP C2 domain first repeat present in Synaptot | 99.83 | |
| cd08395 | 120 | C2C_Munc13 C2 domain third repeat in Munc13 (mamma | 99.83 | |
| cd04031 | 125 | C2A_RIM1alpha C2 domain first repeat contained in | 99.83 | |
| cd08408 | 138 | C2B_Synaptotagmin-14_16 C2 domain second repeat pr | 99.82 | |
| cd08390 | 123 | C2A_Synaptotagmin-15-17 C2A domain first repeat pr | 99.82 | |
| cd08409 | 137 | C2B_Synaptotagmin-15 C2 domain second repeat prese | 99.81 | |
| cd08685 | 119 | C2_RGS-like C2 domain of the Regulator Of G-Protei | 99.81 | |
| cd08692 | 135 | C2B_Tac2-N C2 domain second repeat found in Tac2-N | 99.81 | |
| cd04020 | 162 | C2B_SLP_1-2-3-4 C2 domain second repeat present in | 99.8 | |
| cd08404 | 136 | C2B_Synaptotagmin-4 C2 domain second repeat presen | 99.8 | |
| KOG1028|consensus | 421 | 99.79 | ||
| cd08401 | 121 | C2A_RasA2_RasA3 C2 domain first repeat present in | 99.79 | |
| cd08682 | 126 | C2_Rab11-FIP_classI C2 domain found in Rab11-famil | 99.78 | |
| cd08405 | 136 | C2B_Synaptotagmin-7 C2 domain second repeat presen | 99.78 | |
| cd08410 | 135 | C2B_Synaptotagmin-17 C2 domain second repeat prese | 99.78 | |
| cd08384 | 133 | C2B_Rabphilin_Doc2 C2 domain second repeat present | 99.78 | |
| cd08403 | 134 | C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe | 99.77 | |
| cd08402 | 136 | C2B_Synaptotagmin-1 C2 domain second repeat presen | 99.77 | |
| cd04025 | 123 | C2B_RasA1_RasA4 C2 domain second repeat present in | 99.76 | |
| cd04010 | 148 | C2B_RasA3 C2 domain second repeat present in RAS p | 99.76 | |
| cd04022 | 127 | C2A_MCTP_PRT_plant C2 domain first repeat found in | 99.75 | |
| cd00276 | 134 | C2B_Synaptotagmin C2 domain second repeat present | 99.73 | |
| cd08379 | 126 | C2D_MCTP_PRT_plant C2 domain fourth repeat found i | 99.73 | |
| cd04016 | 121 | C2_Tollip C2 domain present in Toll-interacting pr | 99.72 | |
| cd08400 | 126 | C2_Ras_p21A1 C2 domain present in RAS p21 protein | 99.72 | |
| cd04042 | 121 | C2A_MCTP_PRT C2 domain first repeat found in Multi | 99.72 | |
| cd04035 | 123 | C2A_Rabphilin_Doc2 C2 domain first repeat present | 99.71 | |
| cd08688 | 110 | C2_KIAA0528-like C2 domain found in the Human KIAA | 99.71 | |
| cd08376 | 116 | C2B_MCTP_PRT C2 domain second repeat found in Mult | 99.7 | |
| cd08378 | 121 | C2B_MCTP_PRT_plant C2 domain second repeat found i | 99.7 | |
| cd08678 | 126 | C2_C21orf25-like C2 domain found in the Human chro | 99.69 | |
| cd08690 | 155 | C2_Freud-1 C2 domain found in 5' repressor element | 99.69 | |
| KOG0905|consensus | 1639 | 99.68 | ||
| cd04036 | 119 | C2_cPLA2 C2 domain present in cytosolic PhosphoLip | 99.68 | |
| cd04009 | 133 | C2B_Munc13-like C2 domain second repeat in Munc13 | 99.68 | |
| cd04054 | 121 | C2A_Rasal1_RasA4 C2 domain first repeat present in | 99.67 | |
| cd04033 | 133 | C2_NEDD4_NEDD4L C2 domain present in the Human neu | 99.67 | |
| cd08373 | 127 | C2A_Ferlin C2 domain first repeat in Ferlin. Ferli | 99.66 | |
| cd08675 | 137 | C2B_RasGAP C2 domain second repeat of Ras GTPase a | 99.65 | |
| cd04024 | 128 | C2A_Synaptotagmin-like C2 domain first repeat pres | 99.65 | |
| cd04026 | 131 | C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( | 99.65 | |
| cd08681 | 118 | C2_fungal_Inn1p-like C2 domain found in fungal Ing | 99.64 | |
| cd08394 | 127 | C2A_Munc13 C2 domain first repeat in Munc13 (mamma | 99.64 | |
| cd04019 | 150 | C2C_MCTP_PRT_plant C2 domain third repeat found in | 99.64 | |
| KOG1030|consensus | 168 | 99.64 | ||
| cd04050 | 105 | C2B_Synaptotagmin-like C2 domain second repeat pre | 99.63 | |
| cd04027 | 127 | C2B_Munc13 C2 domain second repeat in Munc13 (mamm | 99.63 | |
| cd04018 | 151 | C2C_Ferlin C2 domain third repeat in Ferlin. Ferli | 99.63 | |
| cd04039 | 108 | C2_PSD C2 domain present in Phosphatidylserine dec | 99.63 | |
| cd04011 | 111 | C2B_Ferlin C2 domain second repeat in Ferlin. Ferl | 99.63 | |
| KOG0696|consensus | 683 | 99.62 | ||
| cd08391 | 121 | C2A_C2C_Synaptotagmin_like C2 domain first and thi | 99.62 | |
| cd08382 | 123 | C2_Smurf-like C2 domain present in Smad ubiquitina | 99.62 | |
| cd08377 | 119 | C2C_MCTP_PRT C2 domain third repeat found in Multi | 99.61 | |
| cd04041 | 111 | C2A_fungal C2 domain first repeat; fungal group. C | 99.6 | |
| cd04014 | 132 | C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) | 99.6 | |
| cd08383 | 117 | C2A_RasGAP C2 domain (first repeat) of Ras GTPase | 99.59 | |
| cd04048 | 120 | C2A_Copine C2 domain first repeat in Copine. There | 99.59 | |
| cd04043 | 126 | C2_Munc13_fungal C2 domain in Munc13 (mammalian un | 99.58 | |
| cd04015 | 158 | C2_plant_PLD C2 domain present in plant phospholip | 99.58 | |
| cd04049 | 124 | C2_putative_Elicitor-responsive_gene C2 domain pre | 99.58 | |
| cd04052 | 111 | C2B_Tricalbin-like C2 domain second repeat present | 99.57 | |
| cd04017 | 135 | C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl | 99.55 | |
| cd04040 | 115 | C2D_Tricalbin-like C2 domain fourth repeat present | 99.55 | |
| cd04051 | 125 | C2_SRC2_like C2 domain present in Soybean genes Re | 99.53 | |
| cd08691 | 137 | C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li | 99.53 | |
| cd08375 | 136 | C2_Intersectin C2 domain present in Intersectin. A | 99.51 | |
| cd04046 | 126 | C2_Calpain C2 domain present in Calpain proteins. | 99.51 | |
| cd04021 | 125 | C2_E3_ubiquitin_ligase C2 domain present in E3 ubi | 99.5 | |
| cd08686 | 118 | C2_ABR C2 domain in the Active BCR (Breakpoint clu | 99.5 | |
| cd04032 | 127 | C2_Perforin C2 domain of Perforin. Perforin contai | 99.5 | |
| cd04045 | 120 | C2C_Tricalbin-like C2 domain third repeat present | 99.5 | |
| cd08676 | 153 | C2A_Munc13-like C2 domain first repeat in Munc13 ( | 99.47 | |
| cd04044 | 124 | C2A_Tricalbin-like C2 domain first repeat present | 99.46 | |
| cd04038 | 145 | C2_ArfGAP C2 domain present in Arf GTPase Activati | 99.45 | |
| cd04013 | 146 | C2_SynGAP_like C2 domain present in Ras GTPase act | 99.45 | |
| cd04037 | 124 | C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli | 99.44 | |
| cd08374 | 133 | C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli | 99.43 | |
| PLN03008 | 868 | Phospholipase D delta | 99.41 | |
| cd04047 | 110 | C2B_Copine C2 domain second repeat in Copine. Ther | 99.34 | |
| cd00275 | 128 | C2_PLC_like C2 domain present in Phosphoinositide- | 99.32 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 99.24 | |
| PLN02223 | 537 | phosphoinositide phospholipase C | 99.2 | |
| PLN02952 | 599 | phosphoinositide phospholipase C | 99.18 | |
| PF00168 | 85 | C2: C2 domain; InterPro: IPR000008 The C2 domain i | 99.16 | |
| KOG2059|consensus | 800 | 99.15 | ||
| cd00030 | 102 | C2 C2 domain. The C2 domain was first identified i | 99.11 | |
| KOG1013|consensus | 362 | 99.09 | ||
| smart00239 | 101 | C2 Protein kinase C conserved region 2 (CalB). Ca2 | 99.08 | |
| PLN02230 | 598 | phosphoinositide phospholipase C 4 | 99.06 | |
| KOG1011|consensus | 1283 | 99.04 | ||
| PLN02222 | 581 | phosphoinositide phospholipase C 2 | 99.02 | |
| KOG2059|consensus | 800 | 98.97 | ||
| KOG1328|consensus | 1103 | 98.93 | ||
| COG5038 | 1227 | Ca2+-dependent lipid-binding protein, contains C2 | 98.89 | |
| PLN02228 | 567 | Phosphoinositide phospholipase C | 98.89 | |
| KOG0169|consensus | 746 | 98.88 | ||
| KOG1328|consensus | 1103 | 98.86 | ||
| KOG1264|consensus | 1267 | 98.67 | ||
| cd08684 | 103 | C2A_Tac2-N C2 domain first repeat found in Tac2-N | 98.59 | |
| KOG1013|consensus | 362 | 98.55 | ||
| COG5038 | 1227 | Ca2+-dependent lipid-binding protein, contains C2 | 98.4 | |
| KOG1031|consensus | 1169 | 98.4 | ||
| PLN02270 | 808 | phospholipase D alpha | 98.36 | |
| KOG1011|consensus | 1283 | 98.36 | ||
| cd08683 | 143 | C2_C2cd3 C2 domain found in C2 calcium-dependent d | 98.24 | |
| cd08689 | 109 | C2_fungal_Pkc1p C2 domain found in protein kinase | 98.01 | |
| KOG2060|consensus | 405 | 97.98 | ||
| PLN02964 | 644 | phosphatidylserine decarboxylase | 97.65 | |
| PLN02352 | 758 | phospholipase D epsilon | 97.53 | |
| KOG1326|consensus | 1105 | 97.46 | ||
| KOG1327|consensus | 529 | 97.32 | ||
| cd08397 | 159 | C2_PI3K_class_III C2 domain present in class III p | 96.53 | |
| KOG1265|consensus | 1189 | 96.14 | ||
| PF00792 | 142 | PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I | 95.98 | |
| cd08380 | 156 | C2_PI3K_like C2 domain present in phosphatidylinos | 95.95 | |
| KOG1326|consensus | 1105 | 95.83 | ||
| KOG3837|consensus | 523 | 95.46 | ||
| PF14429 | 184 | DOCK-C2: C2 domain in Dock180 and Zizimin proteins | 95.28 | |
| cd08398 | 158 | C2_PI3K_class_I_alpha C2 domain present in class I | 95.26 | |
| cd08693 | 173 | C2_PI3K_class_I_beta_delta C2 domain present in cl | 95.21 | |
| cd08694 | 196 | C2_Dock-A C2 domains found in Dedicator Of CytoKin | 95.11 | |
| cd08695 | 189 | C2_Dock-B C2 domains found in Dedicator Of CytoKin | 94.18 | |
| PF15627 | 156 | CEP76-C2: CEP76 C2 domain | 94.07 | |
| cd08399 | 178 | C2_PI3K_class_I_gamma C2 domain present in class I | 93.0 | |
| cd04012 | 171 | C2A_PI3K_class_II C2 domain first repeat present i | 92.67 | |
| cd08679 | 178 | C2_DOCK180_related C2 domains found in Dedicator O | 92.54 | |
| PF12416 | 340 | DUF3668: Cep120 protein; InterPro: IPR022136 This | 91.02 | |
| cd08696 | 179 | C2_Dock-C C2 domains found in Dedicator Of CytoKin | 90.75 | |
| cd08697 | 185 | C2_Dock-D C2 domains found in Dedicator Of CytoKin | 90.48 | |
| KOG1327|consensus | 529 | 87.08 | ||
| smart00142 | 100 | PI3K_C2 Phosphoinositide 3-kinase, region postulat | 86.95 | |
| PF10358 | 143 | NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; | 82.99 |
| >cd08677 C2A_Synaptotagmin-13 C2 domain | Back alignment and domain information |
|---|
Probab=99.94 E-value=1.9e-26 Score=170.93 Aligned_cols=109 Identities=17% Similarity=0.364 Sum_probs=97.1
Q ss_pred cceecchheecccccceeeEEeeec----cCCCccEEEe-----cCeEEeecccCCCCCCeeecEEEecccCcccCCCCE
Q psy12096 51 EDLEMTEAFEDVSEELSSTVASIKK----EIANESMKIA-----DKVAEETGMPPWVVVSIFIERQILEGVPYADAMNKT 121 (173)
Q Consensus 51 ~~l~~~~~~~~~~~~l~~lv~~ik~----~~~dPyVkv~-----~~~k~kTkv~kktlnP~wnEtf~F~gV~~~~l~~~~ 121 (173)
++|++++.|.....+|.+.++.++. +.+|||||++ ++.+++|+++++|+||+|||+|.|. |+.+++.+.+
T Consensus 1 ~~l~fsL~Y~~~~~~L~V~vikA~~L~~~g~sDPYVKv~L~~~~k~~k~kT~v~rktlnPvfnE~f~F~-v~~~~l~~~t 79 (118)
T cd08677 1 PKLHYSLSYDKQKAELHVNILEAENISVDAGCECYISGCVSVSEGQKEAQTALKKLALHTQWEEELVFP-LPEEESLDGT 79 (118)
T ss_pred CeEEEEEEEcCcCCEEEEEEEEecCCCCCCCCCeEEEEEEcCCcCccEEEcceecCCCCCccccEEEEe-CCHHHhCCcE
Confidence 4689999999999999877765532 3479999998 3358899999999999999999999 9999999999
Q ss_pred EEEEEEEcCCCCCCceeEEEEEeCCccccccccceeEeC
Q psy12096 122 LVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWREL 160 (173)
Q Consensus 122 L~~~V~D~d~~~~~d~IG~v~l~L~~l~~~~~~~~W~~L 160 (173)
|.|+|||+|++++|++||++.++|++++...+..+|.+|
T Consensus 80 L~~~V~d~Drfs~~d~IG~v~l~l~~~~~~~~~~~W~~~ 118 (118)
T cd08677 80 LTLTLRCCDRFSRHSTLGELRLKLADVSMMLGAAQWVDL 118 (118)
T ss_pred EEEEEEeCCCCCCCceEEEEEEccccccCCccccchhcC
Confidence 999999999999999999999999998777788999876
|
Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 13, a member of class 6 synaptotagmins, is located in the brain. It functions are unknown. It, like synaptotagmins 8 and 12, does not have any consensus Ca2+ binding sites. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium. Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10). The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B). C2B also regulates also the recycling step of synaptic vesicles. C2 domain |
| >cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 | Back alignment and domain information |
|---|
| >cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 | Back alignment and domain information |
|---|
| >cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >cd08680 C2_Kibra C2 domain found in Human protein Kibra | Back alignment and domain information |
|---|
| >cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 | Back alignment and domain information |
|---|
| >cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 | Back alignment and domain information |
|---|
| >cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 | Back alignment and domain information |
|---|
| >cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 | Back alignment and domain information |
|---|
| >cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 | Back alignment and domain information |
|---|
| >cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 | Back alignment and domain information |
|---|
| >KOG1028|consensus | Back alignment and domain information |
|---|
| >cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins | Back alignment and domain information |
|---|
| >cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 | Back alignment and domain information |
|---|
| >cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 | Back alignment and domain information |
|---|
| >cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 | Back alignment and domain information |
|---|
| >cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family | Back alignment and domain information |
|---|
| >cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) | Back alignment and domain information |
|---|
| >cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 | Back alignment and domain information |
|---|
| >cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 | Back alignment and domain information |
|---|
| >KOG1028|consensus | Back alignment and domain information |
|---|
| >cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 | Back alignment and domain information |
|---|
| >cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I | Back alignment and domain information |
|---|
| >cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 | Back alignment and domain information |
|---|
| >cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 | Back alignment and domain information |
|---|
| >cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) | Back alignment and domain information |
|---|
| >cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin | Back alignment and domain information |
|---|
| >cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) | Back alignment and domain information |
|---|
| >cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) | Back alignment and domain information |
|---|
| >cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone | Back alignment and domain information |
|---|
| >cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein | Back alignment and domain information |
|---|
| >cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) | Back alignment and domain information |
|---|
| >KOG0905|consensus | Back alignment and domain information |
|---|
| >cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) | Back alignment and domain information |
|---|
| >cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) | Back alignment and domain information |
|---|
| >cd08373 C2A_Ferlin C2 domain first repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma | Back alignment and domain information |
|---|
| >cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins | Back alignment and domain information |
|---|
| >cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >KOG1030|consensus | Back alignment and domain information |
|---|
| >cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd04018 C2C_Ferlin C2 domain third repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) | Back alignment and domain information |
|---|
| >cd04011 C2B_Ferlin C2 domain second repeat in Ferlin | Back alignment and domain information |
|---|
| >KOG0696|consensus | Back alignment and domain information |
|---|
| >cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins | Back alignment and domain information |
|---|
| >cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd04041 C2A_fungal C2 domain first repeat; fungal group | Back alignment and domain information |
|---|
| >cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon | Back alignment and domain information |
|---|
| >cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >cd04048 C2A_Copine C2 domain first repeat in Copine | Back alignment and domain information |
|---|
| >cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group | Back alignment and domain information |
|---|
| >cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) | Back alignment and domain information |
|---|
| >cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene | Back alignment and domain information |
|---|
| >cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins | Back alignment and domain information |
|---|
| >cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) | Back alignment and domain information |
|---|
| >cd08375 C2_Intersectin C2 domain present in Intersectin | Back alignment and domain information |
|---|
| >cd04046 C2_Calpain C2 domain present in Calpain proteins | Back alignment and domain information |
|---|
| >cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase | Back alignment and domain information |
|---|
| >cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein | Back alignment and domain information |
|---|
| >cd04032 C2_Perforin C2 domain of Perforin | Back alignment and domain information |
|---|
| >cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) | Back alignment and domain information |
|---|
| >cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family | Back alignment and domain information |
|---|
| >cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin | Back alignment and domain information |
|---|
| >PLN03008 Phospholipase D delta | Back alignment and domain information |
|---|
| >cd04047 C2B_Copine C2 domain second repeat in Copine | Back alignment and domain information |
|---|
| >cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >PLN02223 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >PLN02952 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking | Back alignment and domain information |
|---|
| >KOG2059|consensus | Back alignment and domain information |
|---|
| >cd00030 C2 C2 domain | Back alignment and domain information |
|---|
| >KOG1013|consensus | Back alignment and domain information |
|---|
| >smart00239 C2 Protein kinase C conserved region 2 (CalB) | Back alignment and domain information |
|---|
| >PLN02230 phosphoinositide phospholipase C 4 | Back alignment and domain information |
|---|
| >KOG1011|consensus | Back alignment and domain information |
|---|
| >PLN02222 phosphoinositide phospholipase C 2 | Back alignment and domain information |
|---|
| >KOG2059|consensus | Back alignment and domain information |
|---|
| >KOG1328|consensus | Back alignment and domain information |
|---|
| >COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02228 Phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >KOG0169|consensus | Back alignment and domain information |
|---|
| >KOG1328|consensus | Back alignment and domain information |
|---|
| >KOG1264|consensus | Back alignment and domain information |
|---|
| >cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) | Back alignment and domain information |
|---|
| >KOG1013|consensus | Back alignment and domain information |
|---|
| >COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1031|consensus | Back alignment and domain information |
|---|
| >PLN02270 phospholipase D alpha | Back alignment and domain information |
|---|
| >KOG1011|consensus | Back alignment and domain information |
|---|
| >cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins | Back alignment and domain information |
|---|
| >cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae | Back alignment and domain information |
|---|
| >KOG2060|consensus | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >PLN02352 phospholipase D epsilon | Back alignment and domain information |
|---|
| >KOG1326|consensus | Back alignment and domain information |
|---|
| >KOG1327|consensus | Back alignment and domain information |
|---|
| >cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >KOG1265|consensus | Back alignment and domain information |
|---|
| >PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2 | Back alignment and domain information |
|---|
| >cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >KOG1326|consensus | Back alignment and domain information |
|---|
| >KOG3837|consensus | Back alignment and domain information |
|---|
| >PF14429 DOCK-C2: C2 domain in Dock180 and Zizimin proteins; PDB: 3L4C_A | Back alignment and domain information |
|---|
| >cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd08694 C2_Dock-A C2 domains found in Dedicator Of CytoKinesis (Dock) class A proteins | Back alignment and domain information |
|---|
| >cd08695 C2_Dock-B C2 domains found in Dedicator Of CytoKinesis (Dock) class B proteins | Back alignment and domain information |
|---|
| >PF15627 CEP76-C2: CEP76 C2 domain | Back alignment and domain information |
|---|
| >cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd08679 C2_DOCK180_related C2 domains found in Dedicator Of CytoKinesis 1 (DOCK 180) and related proteins | Back alignment and domain information |
|---|
| >PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length | Back alignment and domain information |
|---|
| >cd08696 C2_Dock-C C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins | Back alignment and domain information |
|---|
| >cd08697 C2_Dock-D C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins | Back alignment and domain information |
|---|
| >KOG1327|consensus | Back alignment and domain information |
|---|
| >smart00142 PI3K_C2 Phosphoinositide 3-kinase, region postulated to contain C2 domain | Back alignment and domain information |
|---|
| >PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 173 | ||||
| 2r83_A | 284 | Crystal Structure Analysis Of Human Synaptotagmin 1 | 4e-14 | ||
| 1byn_A | 128 | Solution Structure Of The Calcium-Bound First C2-Do | 1e-13 | ||
| 1rsy_A | 152 | Structure Of The First C2-domain Of Synaptotagmin I | 1e-13 | ||
| 3f00_A | 143 | Crystal Structure Of Synaptotagmin I C2a Domain Wit | 3e-13 | ||
| 3f04_A | 143 | Crystal Structure Of Synaptotagmin I C2a Domain Len | 3e-13 | ||
| 2d8k_A | 141 | Solution Structure Of The First C2 Domain Of Synapt | 2e-09 | ||
| 2enp_A | 147 | Solution Structure Of The First C2 Domain From Huma | 3e-09 | ||
| 1ugk_A | 138 | Solution Structure Of The First C2 Domain Of Synapt | 9e-05 | ||
| 1dqv_A | 296 | Crystal Structure Of Synaptotagmin Iii C2aC2B Lengt | 1e-04 | ||
| 3hn8_A | 296 | Crystal Structure Of Synaptotagmin Length = 296 | 1e-04 |
| >pdb|2R83|A Chain A, Crystal Structure Analysis Of Human Synaptotagmin 1 C2a-c2b Length = 284 | Back alignment and structure |
|
| >pdb|1BYN|A Chain A, Solution Structure Of The Calcium-Bound First C2-Domain Of Synaptotagmin I Length = 128 | Back alignment and structure |
| >pdb|1RSY|A Chain A, Structure Of The First C2-domain Of Synaptotagmin I: A Novel Ca2+(slash)phospholipid Binding Fold Length = 152 | Back alignment and structure |
| >pdb|3F00|A Chain A, Crystal Structure Of Synaptotagmin I C2a Domain With Cu(Ii) Length = 143 | Back alignment and structure |
| >pdb|3F04|A Chain A, Crystal Structure Of Synaptotagmin I C2a Domain Length = 143 | Back alignment and structure |
| >pdb|2D8K|A Chain A, Solution Structure Of The First C2 Domain Of Synaptotagmin Vii Length = 141 | Back alignment and structure |
| >pdb|2ENP|A Chain A, Solution Structure Of The First C2 Domain From Human BK Protein Length = 147 | Back alignment and structure |
| >pdb|1UGK|A Chain A, Solution Structure Of The First C2 Domain Of Synaptotagmin Iv From Human Fetal Brain (Kiaa1342) Length = 138 | Back alignment and structure |
| >pdb|1DQV|A Chain A, Crystal Structure Of Synaptotagmin Iii C2aC2B Length = 296 | Back alignment and structure |
| >pdb|3HN8|A Chain A, Crystal Structure Of Synaptotagmin Length = 296 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 173 | |||
| 1wfm_A | 138 | Synaptotagmin XIII; C2 domain, exocytosis, neurotr | 5e-18 | |
| 1rsy_A | 152 | Synaptotagmin I; calcium/phospholipid binding prot | 6e-17 | |
| 2b3r_A | 134 | Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA | 8e-17 | |
| 2d8k_A | 141 | Synaptotagmin VII; exocytosis, calcium binding, ly | 8e-17 | |
| 3f04_A | 143 | Synaptotagmin-1; C2A, calcium, cell junction, cyto | 9e-17 | |
| 2enp_A | 147 | B/K protein; C2 type 1,beta sandwich, structural g | 3e-16 | |
| 3fdw_A | 148 | Synaptotagmin-like protein 4; structural genomics, | 4e-16 | |
| 1rh8_A | 142 | Piccolo protein; beta-sandwich, metal binding prot | 5e-16 | |
| 2chd_A | 142 | Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium | 1e-15 | |
| 1ugk_A | 138 | Synaptotagmin IV, KIAA1342; beta sandwich, structu | 2e-15 | |
| 2dmg_A | 142 | KIAA1228 protein; beta-sandwich, structural genomi | 4e-14 | |
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 2e-12 | |
| 2z0u_A | 155 | WW domain-containing protein 1; C2 domain, alterna | 4e-12 | |
| 1v27_A | 141 | Regulating synaptic membrane exocytosis protein 2; | 2e-11 | |
| 1a25_A | 149 | CALB, protein kinase C (beta); calcium++/phospholi | 2e-11 | |
| 2bwq_A | 129 | Regulating synaptic membrane exocytosis protein 2; | 3e-11 | |
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 3e-11 | |
| 2q3x_A | 171 | Regulating synaptic membrane exocytosis protein 1; | 5e-11 | |
| 3rdl_A | 137 | Protein kinase C alpha type; protein kinase PKC, t | 3e-10 | |
| 2dmh_A | 140 | Myoferlin; beta-sandwich, FER-1-like protein 3, mu | 3e-10 | |
| 3fbk_A | 153 | RGS3, RGP3, regulator of G-protein signaling 3; al | 2e-09 | |
| 3b7y_A | 153 | E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- | 6e-09 | |
| 1wfj_A | 136 | Putative elicitor-responsive gene; C2 domain, rike | 1e-07 | |
| 1rlw_A | 126 | Phospholipase A2, CALB domain; hydrolase, C2 domai | 1e-06 | |
| 2cm5_A | 166 | Rabphilin-3A; protein transport, zinc-finger, Ca2+ | 2e-06 | |
| 2ep6_A | 133 | MCTP2 protein; beta sandwich, Ca2+ binding, membra | 2e-06 | |
| 3m7f_B | 176 | E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 | 4e-06 | |
| 3n5a_A | 138 | Synaptotagmin-7; calcium/phospholipid binding prot | 7e-06 | |
| 1w15_A | 153 | Synaptotagmin IV; metal binding protein, endocytos | 3e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-05 | |
| 1tjx_A | 159 | Similar to synaptotagmini/P65; C2B domain, calcium | 5e-05 | |
| 2fk9_A | 157 | Protein kinase C, ETA type; ATP-binding, metal-bin | 3e-04 | |
| 1gmi_A | 136 | Protein kinase C, epsilon type; PKC, C2 domain, X- | 7e-04 |
| >1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 | Back alignment and structure |
|---|
Score = 75.1 bits (185), Expect = 5e-18
Identities = 14/57 (24%), Positives = 25/57 (43%)
Query: 112 VPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQSVEGEGG 168
+ + TL + DRFS+H GE+++ L + +W EL++ G
Sbjct: 82 LAEEELPTATLTLTLRTCDRFSRHSVAGELRLGLDGTSVPLGAAQWGELKTSGPSSG 138
|
| >1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 | Back alignment and structure |
|---|
| >2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Length = 134 | Back alignment and structure |
|---|
| >2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 | Back alignment and structure |
|---|
| >2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 | Back alignment and structure |
|---|
| >1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 | Back alignment and structure |
|---|
| >2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 | Back alignment and structure |
|---|
| >1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 | Back alignment and structure |
|---|
| >2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 142 | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 | Back alignment and structure |
|---|
| >2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 141 | Back alignment and structure |
|---|
| >1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 | Back alignment and structure |
|---|
| >2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Length = 129 | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 | Back alignment and structure |
|---|
| >2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171 | Back alignment and structure |
|---|
| >2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 | Back alignment and structure |
|---|
| >3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153 | Back alignment and structure |
|---|
| >3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 | Back alignment and structure |
|---|
| >1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 | Back alignment and structure |
|---|
| >1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 | Back alignment and structure |
|---|
| >2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Length = 166 | Back alignment and structure |
|---|
| >2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 | Back alignment and structure |
|---|
| >3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 | Back alignment and structure |
|---|
| >3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138 | Back alignment and structure |
|---|
| >1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Length = 153 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159 | Back alignment and structure |
|---|
| >2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 | Back alignment and structure |
|---|
| >1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 173 | |||
| 1wfm_A | 138 | Synaptotagmin XIII; C2 domain, exocytosis, neurotr | 99.91 | |
| 3f04_A | 143 | Synaptotagmin-1; C2A, calcium, cell junction, cyto | 99.88 | |
| 2z0u_A | 155 | WW domain-containing protein 1; C2 domain, alterna | 99.87 | |
| 3fdw_A | 148 | Synaptotagmin-like protein 4; structural genomics, | 99.86 | |
| 1rsy_A | 152 | Synaptotagmin I; calcium/phospholipid binding prot | 99.86 | |
| 2enp_A | 147 | B/K protein; C2 type 1,beta sandwich, structural g | 99.86 | |
| 2d8k_A | 141 | Synaptotagmin VII; exocytosis, calcium binding, ly | 99.85 | |
| 2dmg_A | 142 | KIAA1228 protein; beta-sandwich, structural genomi | 99.85 | |
| 1ugk_A | 138 | Synaptotagmin IV, KIAA1342; beta sandwich, structu | 99.84 | |
| 3fbk_A | 153 | RGS3, RGP3, regulator of G-protein signaling 3; al | 99.83 | |
| 3n5a_A | 138 | Synaptotagmin-7; calcium/phospholipid binding prot | 99.83 | |
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 99.83 | |
| 1tjx_A | 159 | Similar to synaptotagmini/P65; C2B domain, calcium | 99.82 | |
| 2bwq_A | 129 | Regulating synaptic membrane exocytosis protein 2; | 99.82 | |
| 2b3r_A | 134 | Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA | 99.82 | |
| 1v27_A | 141 | Regulating synaptic membrane exocytosis protein 2; | 99.82 | |
| 1rh8_A | 142 | Piccolo protein; beta-sandwich, metal binding prot | 99.81 | |
| 2cm5_A | 166 | Rabphilin-3A; protein transport, zinc-finger, Ca2+ | 99.81 | |
| 2chd_A | 142 | Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium | 99.81 | |
| 1w15_A | 153 | Synaptotagmin IV; metal binding protein, endocytos | 99.8 | |
| 2q3x_A | 171 | Regulating synaptic membrane exocytosis protein 1; | 99.8 | |
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 99.8 | |
| 3rdl_A | 137 | Protein kinase C alpha type; protein kinase PKC, t | 99.79 | |
| 1a25_A | 149 | CALB, protein kinase C (beta); calcium++/phospholi | 99.77 | |
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 99.77 | |
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 99.75 | |
| 3kwu_A | 148 | MUNC13-1; calcium binding protein, phospholipid bi | 99.75 | |
| 2ep6_A | 133 | MCTP2 protein; beta sandwich, Ca2+ binding, membra | 99.74 | |
| 3b7y_A | 153 | E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- | 99.72 | |
| 2fk9_A | 157 | Protein kinase C, ETA type; ATP-binding, metal-bin | 99.72 | |
| 2dmh_A | 140 | Myoferlin; beta-sandwich, FER-1-like protein 3, mu | 99.71 | |
| 1rlw_A | 126 | Phospholipase A2, CALB domain; hydrolase, C2 domai | 99.71 | |
| 3m7f_B | 176 | E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 | 99.71 | |
| 1gmi_A | 136 | Protein kinase C, epsilon type; PKC, C2 domain, X- | 99.7 | |
| 3pyc_A | 132 | E3 ubiquitin-protein ligase smurf1; phospholipid b | 99.7 | |
| 1wfj_A | 136 | Putative elicitor-responsive gene; C2 domain, rike | 99.68 | |
| 2nq3_A | 173 | Itchy homolog E3 ubiquitin protein ligase; C2 doma | 99.68 | |
| 2cjt_A | 131 | UNC-13 homolog A, MUNC13-1; phorbol-ester binding, | 99.6 | |
| 3l9b_A | 144 | Otoferlin; C2-domain, beta-sheets, cell membrane, | 99.54 | |
| 2cjs_A | 167 | UNC-13 homolog A, MUNC13-1; neurotransmitter trans | 99.5 | |
| 3jzy_A | 510 | Intersectin 2; C2 domain, structural genomics cons | 99.46 | |
| 1cjy_A | 749 | CPLA2, protein (cytosolic phospholipase A2); lipid | 99.43 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 99.41 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 99.37 | |
| 3nsj_A | 540 | Perforin-1; pore forming protein, immune system; H | 99.37 | |
| 3bxj_A | 483 | RAS GTPase-activating protein syngap; GTPase activ | 99.32 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 99.03 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 99.02 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.0 | |
| 1yrk_A | 126 | NPKC-delta, protein kinase C, delta type; C2 domai | 98.72 | |
| 2enj_A | 138 | NPKC-theta, protein kinase C theta type; beta-sand | 98.63 | |
| 3l4c_A | 220 | Dedicator of cytokinesis protein 1; DOCK180, DOCK1 | 95.57 | |
| 2wxf_A | 940 | Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca | 88.79 | |
| 1e7u_A | 961 | Phosphatidylinositol 3-kinase catalytic subunit; p | 86.08 | |
| 3hhm_A | 1091 | Phosphatidylinositol-4,5-bisphosphate 3-kinase cat | 82.89 |
| >1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
Probab=99.91 E-value=1.3e-23 Score=156.72 Aligned_cols=121 Identities=17% Similarity=0.230 Sum_probs=104.3
Q ss_pred CCCcccceecchheecccccceeeEEeeec----cCCCccEEEe-----cCeEEeecccCCCCCCeeecEEEecccCccc
Q psy12096 46 PEDEEEDLEMTEAFEDVSEELSSTVASIKK----EIANESMKIA-----DKVAEETGMPPWVVVSIFIERQILEGVPYAD 116 (173)
Q Consensus 46 ~~~~~~~l~~~~~~~~~~~~l~~lv~~ik~----~~~dPyVkv~-----~~~k~kTkv~kktlnP~wnEtf~F~gV~~~~ 116 (173)
.....|+|++++.|.....+|.+.|+..+. +..||||+++ .+.++||+++++|+||+|||+|.|. ++..+
T Consensus 8 s~~~~G~l~~sl~y~~~~~~L~V~v~~a~~~d~~g~sDPyv~v~l~~~~~~~~~kT~v~~~tlnP~wnE~f~f~-v~~~~ 86 (138)
T 1wfm_A 8 SWNQAPKLHYCLDYDCQKAELFVTRLEAVTSNHDGGCDCYVQGSVANRTGSVEAQTALKKRQLHTTWEEGLVLP-LAEEE 86 (138)
T ss_dssp CCSSCCEEEEEEEEETTTTEEEEEEEEEECCCCSSCCCEEEEEEEEETTEEEEEECCCCCCCSSEECSSCEEEE-CCTTS
T ss_pred CCCcceEEEEEEEEeCCCCEEEEEEEEEEcCCCCCCcceEEEEEEEcCCCcccEecccCcCCCCCcCCceEEEE-ecHHH
Confidence 345569999999999988888877776653 3479999998 1236899999999999999999999 99888
Q ss_pred CCCCEEEEEEEEcCCCCCCceeEEEEEeCCccccccccceeEeCccCCccc
Q psy12096 117 AMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQSVEGEG 167 (173)
Q Consensus 117 l~~~~L~~~V~D~d~~~~~d~IG~v~l~L~~l~~~~~~~~W~~L~p~~~~~ 167 (173)
+....|.|.|||+|+++++++||++.++|.++.......+|++|++..+++
T Consensus 87 l~~~~L~~~V~d~d~~~~dd~lG~~~i~l~~l~~~~~~~~W~~L~~~~~~~ 137 (138)
T 1wfm_A 87 LPTATLTLTLRTCDRFSRHSVAGELRLGLDGTSVPLGAAQWGELKTSGPSS 137 (138)
T ss_dssp STTCEEEEEEEECCSSCTTSCSEEEEEESSSSSSCTTCCEEEECCCCSCCC
T ss_pred cCCCEEEEEEEECCCCCCCcEEEEEEEEcccccCcccccceeeCcCCCcCC
Confidence 877899999999999999999999999999998777778999999976654
|
| >3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* | Back alignment and structure |
|---|
| >2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 | Back alignment and structure |
|---|
| >3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* | Back alignment and structure |
|---|
| >2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A | Back alignment and structure |
|---|
| >2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A | Back alignment and structure |
|---|
| >1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A | Back alignment and structure |
|---|
| >2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A | Back alignment and structure |
|---|
| >3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* | Back alignment and structure |
|---|
| >2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A | Back alignment and structure |
|---|
| >2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A | Back alignment and structure |
|---|
| >1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B | Back alignment and structure |
|---|
| >1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A | Back alignment and structure |
|---|
| >2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l4c_A Dedicator of cytokinesis protein 1; DOCK180, DOCK1, phosphoinositide specificity, guanine exchan factor, RHO GTPase, cytoskeleton, cell migration; 2.37A {Homo sapiens} | Back alignment and structure |
|---|
| >2wxf_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit delta isoform; transferase, phosphoprotein, isoform-specific inhibitors; HET: 039; 1.90A {Mus musculus} PDB: 2wxg_A* 2wxh_A* 2wxi_A* 2wxj_A* 2wxk_A* 2wxl_A* 2wxm_A* 2wxn_A* 2wxo_A* 2wxp_A* 2wxq_A* 2wxr_A 2x38_A* | Back alignment and structure |
|---|
| >3hhm_A Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_A 2rd0_A 4a55_A* 2enq_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 173 | ||||
| d1rsya_ | 143 | b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu | 2e-10 | |
| d1ugka_ | 138 | b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens | 2e-09 | |
| d1rh8a_ | 142 | b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax | 2e-07 | |
| d2bwqa1 | 125 | b.7.1.2 (A:729-853) Regulating synaptic membrane e | 3e-07 | |
| d1wfma_ | 138 | b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapie | 4e-07 | |
| d1a25a_ | 132 | b.7.1.2 (A:) C2 domain from protein kinase c (beta | 5e-07 | |
| d1dqva1 | 130 | b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus | 1e-06 | |
| d1dqva2 | 145 | b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus | 1e-05 | |
| d1w15a_ | 138 | b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi | 2e-05 | |
| d1uowa_ | 157 | b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu | 1e-04 | |
| d1wfja_ | 136 | b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr | 2e-04 | |
| d1rlwa_ | 126 | b.7.1.1 (A:) Domain from cytosolic phospholipase A | 2e-04 | |
| d2cm5a1 | 137 | b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( | 5e-04 | |
| d2ep6a1 | 126 | b.7.1.1 (A:92-217) Multiple C2 and transmembrane d | 0.001 |
| >d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 | Back information, alignment and structure |
|---|
class: All beta proteins fold: C2 domain-like superfamily: C2 domain (Calcium/lipid-binding domain, CaLB) family: Synaptotagmin-like (S variant) domain: Synaptogamin I species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 54.0 bits (129), Expect = 2e-10
Identities = 30/51 (58%), Positives = 37/51 (72%)
Query: 112 VPYADAMNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQS 162
VPY++ KTLV A++DFDRFSKHD IGE KV + +D EEWR+LQS
Sbjct: 92 VPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQS 142
|
| >d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 | Back information, alignment and structure |
|---|
| >d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 | Back information, alignment and structure |
|---|
| >d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Length = 138 | Back information, alignment and structure |
|---|
| >d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 | Back information, alignment and structure |
|---|
| >d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 130 | Back information, alignment and structure |
|---|
| >d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 | Back information, alignment and structure |
|---|
| >d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 | Back information, alignment and structure |
|---|
| >d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 | Back information, alignment and structure |
|---|
| >d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 | Back information, alignment and structure |
|---|
| >d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
| >d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 | Back information, alignment and structure |
|---|
| >d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 173 | |||
| d1wfma_ | 138 | Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 | 99.88 | |
| d1rsya_ | 143 | Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 | 99.88 | |
| d2bwqa1 | 125 | Regulating synaptic membrane exocytosis protein, r | 99.84 | |
| d1rh8a_ | 142 | Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.84 | |
| d1dqva1 | 130 | Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: | 99.83 | |
| d1uowa_ | 157 | Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 | 99.82 | |
| d1w15a_ | 138 | Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: | 99.82 | |
| d1a25a_ | 132 | C2 domain from protein kinase c (beta) {Rat (Rattu | 99.82 | |
| d1ugka_ | 138 | Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 | 99.82 | |
| d2cm5a1 | 137 | C2b-domain of rabphilin {Rat (Rattus norvegicus) [ | 99.81 | |
| d1dqva2 | 145 | Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: | 99.79 | |
| d2ep6a1 | 126 | Multiple C2 and transmembrane domain-containing pr | 99.72 | |
| d1rlwa_ | 126 | Domain from cytosolic phospholipase A2 {Human (Hom | 99.7 | |
| d2nq3a1 | 133 | E3 ubiquitin-protein ligase Itchy {Human (Homo sap | 99.65 | |
| d2cjta1 | 128 | Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: | 99.65 | |
| d1qasa2 | 131 | PI-specific phospholipase C isozyme D1 (PLC-D1), C | 99.62 | |
| d1gmia_ | 136 | Domain from protein kinase C epsilon {Rat (Rattus | 99.61 | |
| d1wfja_ | 136 | C2 domain protein At1g63220 {Thale cress (Arabidop | 99.55 | |
| d1bdya_ | 123 | Domain from protein kinase C delta {Rat (Rattus no | 99.52 | |
| d2zkmx2 | 122 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 99.29 | |
| d1e7ua2 | 174 | Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) | 94.33 |
| >d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: C2 domain-like superfamily: C2 domain (Calcium/lipid-binding domain, CaLB) family: Synaptotagmin-like (S variant) domain: Synaptotagmin XIII species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.88 E-value=1.9e-22 Score=149.10 Aligned_cols=118 Identities=18% Similarity=0.234 Sum_probs=103.1
Q ss_pred CCcccceecchheecccccceeeEEeee----ccCCCccEEEe-----cCeEEeecccCCCCCCeeecEEEecccCcccC
Q psy12096 47 EDEEEDLEMTEAFEDVSEELSSTVASIK----KEIANESMKIA-----DKVAEETGMPPWVVVSIFIERQILEGVPYADA 117 (173)
Q Consensus 47 ~~~~~~l~~~~~~~~~~~~l~~lv~~ik----~~~~dPyVkv~-----~~~k~kTkv~kktlnP~wnEtf~F~gV~~~~l 117 (173)
..+..+|++++.|....++|.+.|+..+ .+..||||+++ ...++||++++++.||.|||+|.|. |+..++
T Consensus 9 ~~~~~~l~~sl~y~~~~~~L~V~v~~a~~L~~~g~~dpyVkv~l~~~~~~~~~kT~v~~~~~~P~wne~f~f~-v~~~~l 87 (138)
T d1wfma_ 9 WNQAPKLHYCLDYDCQKAELFVTRLEAVTSNHDGGCDCYVQGSVANRTGSVEAQTALKKRQLHTTWEEGLVLP-LAEEEL 87 (138)
T ss_dssp CSSCCEEEEEEEEETTTTEEEEEEEEEECCCCSSCCCEEEEEEEEETTEEEEEECCCCCCCSSEECSSCEEEE-CCTTSS
T ss_pred CCcCCEEEEEEEECCCCCEEEEEEEEcCCCCCCCCcCcEEEEEECCCCCccceeeeEECCCCCceEeeeEEEE-eeehhc
Confidence 5667899999999999888887776654 24569999998 2236889999999999999999999 998888
Q ss_pred CCCEEEEEEEEcCCCCCCceeEEEEEeCCccccccccceeEeCccCCc
Q psy12096 118 MNKTLVFAIFDFDRFSKHDQIGEVKVALCQIDLAQTIEEWRELQSVEG 165 (173)
Q Consensus 118 ~~~~L~~~V~D~d~~~~~d~IG~v~l~L~~l~~~~~~~~W~~L~p~~~ 165 (173)
....|.|+|||+++++++++||++.|+|.++......+.|++|++...
T Consensus 88 ~~~~L~~~V~d~~~~~~~~~iG~~~i~L~~l~~~~~~~~W~~L~~~~~ 135 (138)
T d1wfma_ 88 PTATLTLTLRTCDRFSRHSVAGELRLGLDGTSVPLGAAQWGELKTSGP 135 (138)
T ss_dssp TTCEEEEEEEECCSSCTTSCSEEEEEESSSSSSCTTCCEEEECCCCSC
T ss_pred cceEEEEEEeeecccccceeeeEEEEEhHHccCCCCceEeEeCCCCCC
Confidence 888999999999999999999999999999987778899999988654
|
| >d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|