Diaphorina citri psyllid: psy12097


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70----
MSQVNPPCTLEHPENQSRVDYIHNVASAHDFDYPPEFYDIAEELWKDKGVQACFERSNEYQLIDCAKYLVSLVK
cccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHcccHHHHHHHcccccccccccHHHHHcccc
**QVNPPCTLEHPENQSRVDYIHNVASAHDFDYPPEFYDIAEELWKDKGVQACFERSNEYQLIDCAKYLVSLVK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQVNPPCTLEHPENQSRVDYIHNVASAHDFDYPPEFYDIAEELWKDKGVQACFERSNEYQLIDCAKYLVSLVK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Guanine nucleotide-binding protein G(s) subunit alpha Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(s) protein is involved in hormonal regulation of adenylate cyclase: it activates the cyclase.confidentP20354
Guanine nucleotide-binding protein G(s) subunit alpha Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(s) protein is involved in hormonal regulation of adenylate cyclase: it activates the cyclase. Participates in olfactory signal transduction.confidentQ7PD79
Guanine nucleotide-binding protein G(s) subunit alpha Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(s) protein is involved in hormonal regulation of adenylate cyclase: it activates the cyclase in response to beta-adrenergic stimuli.confidentQ8R4A8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005834 [CC]heterotrimeric G-protein complexprobableGO:0043234, GO:0019897, GO:0032991, GO:0016020, GO:0044464, GO:0009898, GO:0019898, GO:0005575, GO:0071944, GO:0005623, GO:0005886, GO:0044424, GO:0044425, GO:0005622, GO:0044459, GO:0031234
GO:0003924 [MF]GTPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0001750 [CC]photoreceptor outer segmentprobableGO:0072372, GO:0043231, GO:0044464, GO:0005623, GO:0031513, GO:0005575, GO:0043229, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0043226, GO:0005622
GO:0032794 [MF]GTPase activating protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0009416 [BP]response to light stimulusprobableGO:0009314, GO:0050896, GO:0008150, GO:0009628
GO:0044463 [CC]cell projection partprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0050909 [BP]sensory perception of tasteprobableGO:0032501, GO:0044707, GO:0050877, GO:0007606, GO:0007600, GO:0008150, GO:0044699, GO:0003008
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0071870 [BP]cellular response to catecholamine stimulusprobableGO:0070887, GO:0071867, GO:0071868, GO:0071869, GO:0044699, GO:0009719, GO:0051716, GO:1901698, GO:0071417, GO:0071310, GO:0014070, GO:0071495, GO:0009987, GO:0044763, GO:0042221, GO:0010033, GO:1901700, GO:1901701, GO:0071407, GO:0050896, GO:1901699, GO:0008150, GO:0010243
GO:0051336 [BP]regulation of hydrolase activityprobableGO:0019222, GO:0050790, GO:0008150, GO:0065007, GO:0065009, GO:0050789
GO:0032588 [CC]trans-Golgi network membraneprobableGO:0005802, GO:0031090, GO:0016020, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0019003 [MF]GDP bindingprobableGO:0043168, GO:0017076, GO:0019001, GO:0097159, GO:1901363, GO:1901265, GO:0043167, GO:0036094, GO:0032561, GO:0003674, GO:0032553, GO:0032549, GO:0032555, GO:0005488, GO:0000166, GO:0032550, GO:0001883, GO:0001882
GO:0005102 [MF]receptor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0005604 [CC]basement membraneprobableGO:0005578, GO:0031012, GO:0005575, GO:0005576, GO:0044420, GO:0044421
GO:0005525 [MF]GTP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0019001, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032561, GO:0032553, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0007191 [BP]adenylate cyclase-activating dopamine receptor signaling pathwayprobableGO:0065007, GO:0044700, GO:0051716, GO:0008150, GO:0007212, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0050789, GO:0007188, GO:0007189, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0007186, GO:0007187, GO:0044699
GO:0007190 [BP]activation of adenylate cyclase activityprobableGO:0019220, GO:0031281, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0031323, GO:0051339, GO:0045981, GO:0043085, GO:0009893, GO:0030819, GO:0030816, GO:0045761, GO:0045762, GO:0009891, GO:0030810, GO:0050789, GO:0065007, GO:0044093, GO:0051349, GO:0048518, GO:0065009, GO:0045935, GO:0045937, GO:0019219, GO:0050790, GO:0009889, GO:0050794, GO:0051174, GO:1900542, GO:0008150, GO:0051171, GO:0051173, GO:0030799, GO:0031279, GO:1900544, GO:1900371, GO:0030808, GO:0080090, GO:0030804, GO:0030801, GO:1900373, GO:0030802, GO:0030817, GO:0006140, GO:0030814, GO:0010562, GO:0048522
GO:0007268 [BP]synaptic transmissionprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0044699, GO:0003008
GO:0030496 [CC]midbodyprobableGO:0005575, GO:0044464, GO:0005623
GO:0071380 [BP]cellular response to prostaglandin E stimulusprobableGO:0070887, GO:0044699, GO:0009719, GO:0051716, GO:0071379, GO:0071310, GO:0034694, GO:0034695, GO:0071495, GO:0071398, GO:0009987, GO:0071396, GO:0032870, GO:0008150, GO:0042221, GO:0010033, GO:1901700, GO:1901701, GO:0009725, GO:0070542, GO:0033993, GO:0044763, GO:0050896
GO:0045121 [CC]membrane raftprobableGO:0005575, GO:0044425, GO:0016020
GO:0006184 [BP]GTP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0009203, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0071704, GO:0042278, GO:1901069, GO:1901068, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0046039, GO:0044238, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0097458 [CC]neuron partprobableGO:0005575, GO:0044464, GO:0005623
GO:0031224 [CC]intrinsic to membraneprobableGO:0005575, GO:0044425, GO:0016020
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0050805 [BP]negative regulation of synaptic transmissionprobableGO:0044057, GO:0050794, GO:0031644, GO:0031645, GO:0051241, GO:0050804, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0051239, GO:0023051, GO:0048519, GO:0051969, GO:0010646, GO:0051970, GO:0050789, GO:0048523
GO:0051301 [BP]cell divisionprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1AZS, chain C
Confidence level:very confident
Coverage over the Query: 3-74
View the alignment between query and template
View the model in PyMOL