Diaphorina citri psyllid: psy1209


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60-
MGILGLAKLVADVAPSSIRESRKICIDASMSLYQFLIAVRSEGNQLMSVDGEPTRYSVYKL
ccHHHHHHHHHHHccHHHHHccEEEEEHHHHHHHHHHHHHHccccccccccccCCcccccc
MGILGLAKLVADVAPSSIRESRKICIDASMSLYQFLIAVRS***********PTRYSVYKL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGILGLAKLVADVAPSSIRESRKICIDASMSLYQFLIAVRSEGNQLMSVDGEPTRYSVYKL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Flap endonuclease 1 Structure-specific nuclease with 5'-flap endonuclease and 5'-3' exonuclease activities involved in DNA replication and repair. During DNA replication, cleaves the 5'-overhanging flap structure that is generated by displacement synthesis when DNA polymerase encounters the 5'-end of a downstream Okazaki fragment. It enters the flap from the 5'-end and then tracks to cleave the flap base, leaving a nick for ligation. Also involved in the long patch base excision repair (LP-BER) pathway, by cleaving within the apurinic/apyrimidinic (AP) site-terminated flap. Acts as a genome stabilization factor that prevents flaps from equilibrating into structurs that lead to duplications and deletions. Also possesses 5'-3' exonuclease activity on nicked or gapped double-stranded DNA, and exhibits RNase H activity. Also involved in replication and repair of rDNA and in repairing mitochondrial DNA.confidentB5DUR8
Flap endonuclease 1 Structure-specific nuclease with 5'-flap endonuclease and 5'-3' exonuclease activities involved in DNA replication and repair. During DNA replication, cleaves the 5'-overhanging flap structure that is generated by displacement synthesis when DNA polymerase encounters the 5'-end of a downstream Okazaki fragment. It enters the flap from the 5'-end and then tracks to cleave the flap base, leaving a nick for ligation. Also involved in the long patch base excision repair (LP-BER) pathway, by cleaving within the apurinic/apyrimidinic (AP) site-terminated flap. Acts as a genome stabilization factor that prevents flaps from equilibrating into structurs that lead to duplications and deletions. Also possesses 5'-3' exonuclease activity on nicked or gapped double-stranded DNA, and exhibits RNase H activity. Also involved in replication and repair of rDNA and in repairing mitochondrial DNA (By similarity). Can associate and cooperate with cps-6 to promote stepwise DNA fragmentation, utilizing the endonuclease activity of cps-6 and both of its own 5'-3' exonuclease activity and gap-dependent endonuclease activity. May play a critical role in switching the state of cells from DNA replication/repair to DNA degradation during apoptosis.confidentQ9N3T2
Flap endonuclease 1 Structure-specific nuclease with 5'-flap endonuclease and 5'-3' exonuclease activities involved in DNA replication and repair. During DNA replication, cleaves the 5'-overhanging flap structure that is generated by displacement synthesis when DNA polymerase encounters the 5'-end of a downstream Okazaki fragment. It enters the flap from the 5'-end and then tracks to cleave the flap base, leaving a nick for ligation. Also involved in the long patch base excision repair (LP-BER) pathway, by cleaving within the apurinic/apyrimidinic (AP) site-terminated flap. Acts as a genome stabilization factor that prevents flaps from equilibrating into structurs that lead to duplications and deletions. Also possesses 5'-3' exonuclease activity on nicked or gapped double-stranded DNA, and exhibits RNase H activity. Also involved in replication and repair of rDNA and in repairing mitochondrial DNA.confidentQ5ZLN4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0017108 [MF]5'-flap endonuclease activityprobableGO:0004518, GO:0016787, GO:0004536, GO:0004519, GO:0003824, GO:0004520, GO:0016788, GO:0016893, GO:0003674, GO:0048256, GO:0016888
GO:0006303 [BP]double-strand break repair via nonhomologous end joiningprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0000726, GO:0044260, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0006302, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0065007 [BP]biological regulationprobableGO:0008150
GO:0006284 [BP]base-excision repairprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0004523 [MF]ribonuclease H activityprobableGO:0016787, GO:0003824, GO:0004518, GO:0004519, GO:0004540, GO:0004521, GO:0016788, GO:0016893, GO:0016891, GO:0003674
GO:0043137 [BP]DNA replication, removal of RNA primerprobableGO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901576, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0033567, GO:0071704, GO:0006260, GO:0006261, GO:0006401, GO:0022616, GO:0044238, GO:0009987, GO:0006725, GO:0046700, GO:0006259, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0046483, GO:0016070, GO:0044248, GO:0044270, GO:0006273, GO:0006271, GO:0044237, GO:0043170, GO:0019439
GO:0030145 [MF]manganese ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0000287 [MF]magnesium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0045145 [MF]single-stranded DNA specific 5'-3' exodeoxyribonuclease activityprobableGO:0016787, GO:0008409, GO:0004529, GO:0003824, GO:0004536, GO:0004527, GO:0016788, GO:0004518, GO:0016796, GO:0003674, GO:0016895, GO:0035312, GO:0008297
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0048731 [BP]system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3Q8K, chain A
Confidence level:very confident
Coverage over the Query: 2-59
View the alignment between query and template
View the model in PyMOL