Diaphorina citri psyllid: psy12108

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-----

MVAGRSQQRAIAQMVTYGDSKHNQRNVAQLQATTNRKLKETVALELSFVNSNLQLLKEQLAELNSSVELYQNDKRSLDSVESVYRLFSLMILFMLSTRDRKTPRSFKYFSKEPVMPMIPLGLKETKEIDVREPFKDFILEHYSEDGTAYEDSVSEFMDMRQAMRTPNRDNSGISLLFQYYNQLYFIERRFFPPDRSLGIYFEYDSLTGVPSCQRTIAFEKACVLFNMAAIYTQMAAKQDRLTSTGLDQAVDNFLRAAGTFTYLQENFTNAPSMDLGPPMLDMLIQLMLAQARECLFQKLQLQTTEKCDFQHMLELAQEAAQVAEVYMSLLSLITVPEVKDYVPLSWVSLIQVKKEHYLALSHYYCASGLLTKSLANLSSTAQTVLSYLHIPQENKKNLILEFEPEDESQRKQLGVAHLRSALLFHEESQRIYRMCRELRNKQALFQVLVQAHTLTLEMYADVEEEDEFNTMYEAPNITPSTKFQLTLTPPDFAHLPVEDLFKQLGPVAIFSAKHHWTAPRSIQLQRANNSDTGFGFSVRGDAPVIVASVDSGSLAQFGGMKDGDFIVAIGDRDVKWSPHEEVVQLIKDAGKCLSLKLVTPMHKNNNVHHSHNSRIKGTESIKESKTSEKNQSPSSSITPSRKQIWNPFKKHQRDHELCYNHMTTT

ccccHHHHHHHHHHHHcccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccccccccEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHcHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHccccccccccccHHHHccccccccccEEEEccccEEEEEEccccHHHHcccccccEEEEEcccccccccHHHHHHHHHHccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

**********************************NRKLKETVALELSFVNSNLQLLKEQLAELNSSVELYQNDKRSLDSVESVYRLFSLMILFMLSTRD*********FSKEPVMPMIPLGLKETKEIDVREPFKDFILEHYSEDGTAYEDSVSEFMDMRQA*********GISLLFQYYNQLYFIERRFFPPDRSLGIYFEYDSLTGVPSCQRTIAFEKACVLFNMAAIYTQMAAKQDRLTSTGLDQAVDNFLRAAGTFTYLQENFTNAPSMDLGPPMLDMLIQLMLAQARECLFQKLQLQTTEKCDFQHMLELAQEAAQVAEVYMSLLSLITVPEVKDYVPLSWVSLIQVKKEHYLALSHYYCASGLLTKSLANLSSTAQTVLSYLHIPQENKKNLILE***********LGVAHLRSALLFHEESQRIYRMCRELRNKQALFQVLVQAHTLTLEMYADVEEEDEFNTMYEAPNITPSTKFQLTLTPPDFAHLPVEDLFKQLGPVAIFSAKHHWTAPRSIQLQRANNSDTGFGFSVRGDAPVIVASVDSGSLAQFGGMKDGDFIVAIGDRDVKWSPHEEVVQLIKDAGKCLSLKLVTP*****************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MVAGRSQQRAIAQMVTYGDSKHNQRNVAQLQATTNRKLKETVALExxxxxxxxxxxxxxxxxxxxxxxxxxxxKRSLDSVESVYRLFSLMILFMLSTRDRKTPRSFKYFSKEPVMPMIPLGLKETKEIDVREPFKDFILEHYSEDGTAYEDSVSEFMDMRQAMRTPNRDNSGISLLFQYYNQLYFIERRFFPPDRSLGIYFEYDSLTGVPSCQRTIAFEKACVLFNMAAIYTQMAAKQDRLTSTGLDQAVDNFLRAAGTFTYLQENFTNAPSMDLGPPMLDMLIQLMLAQARECLFQKLQLQTTEKCDFQHMLELAQEAAQVAEVYMSLLSLITVPEVKDYVPLSWVSLIQVKKEHYLALSHYYCASGLLTKSLANLSSTAQTVLSYLHIPQENKKNLILEFEPEDESQRKQLGVAHLRSALLFHEESQRIYRMCRELRNKQALFQVLVQAHTLTLEMYADVEEEDEFNTMYEAPNITPSTKFQLTLTPPDFAHLPVEDLFKQLGPVAIFSAKHHWTAPRSIQLQRANNSDTGFGFSVRGDAPVIVASVDSGSLAQFGGMKDGDFIVAIGDRDVKWSPHEEVVQLIKDAGKCLSLKLVTPMHKNNNVHHSHNSRIKGTESIKESKTSEKNQSPSSSITPSRKQIWNPFKKHQRDHELCYNHMTTT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Rhophilin-1	Has no enzymatic activity. May serve as a target for Rho, and interact with some cytoskeletal component upon Rho binding or relay a Rho signal to other molecules.	confident	Q61085
Rhophilin-2	Binds specifically to GTP-Rho. May function in a Rho pathway to limit stress fiber formation and/or increase the turnover of F-actin structures in the absence of high levels of RhoA activity.	confident	Q8IUC4
Rhophilin-2	Binds specifically to GTP-Rho. May function in a Rho pathway to limit stress fiber formation and/or increase the turnover of F-actin structures in the absence of high levels of RhoA activity.	confident	Q8HXG3

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0050789 [BP]	regulation of biological process	probable	GO:0008150, GO:0065007
GO:0005575 [CC]	cellular_component	probable

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZB1, chain A
Confidence level:very confident
Coverage over the Query: 114-373,410-505
View the alignment between query and template
View the model in PyMOL

Template: 1VAE, chain A
Confidence level:very confident
Coverage over the Query: 508-608
View the alignment between query and template
View the model in PyMOL

Template: 1CXZ, chain B
Confidence level:confident
Coverage over the Query: 30-43
View the alignment between query and template
View the model in PyMOL