Psyllid ID: psy12108

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-----
MVAGRSQQRAIAQMVTYGDSKHNQRNVAQLQATTNRKLKETVALELSFVNSNLQLLKEQLAELNSSVELYQNDKRSLDSVESVYRLFSLMILFMLSTRDRKTPRSFKYFSKEPVMPMIPLGLKETKEIDVREPFKDFILEHYSEDGTAYEDSVSEFMDMRQAMRTPNRDNSGISLLFQYYNQLYFIERRFFPPDRSLGIYFEYDSLTGVPSCQRTIAFEKACVLFNMAAIYTQMAAKQDRLTSTGLDQAVDNFLRAAGTFTYLQENFTNAPSMDLGPPMLDMLIQLMLAQARECLFQKLQLQTTEKCDFQHMLELAQEAAQVAEVYMSLLSLITVPEVKDYVPLSWVSLIQVKKEHYLALSHYYCASGLLTKSLANLSSTAQTVLSYLHIPQENKKNLILEFEPEDESQRKQLGVAHLRSALLFHEESQRIYRMCRELRNKQALFQVLVQAHTLTLEMYADVEEEDEFNTMYEAPNITPSTKFQLTLTPPDFAHLPVEDLFKQLGPVAIFSAKHHWTAPRSIQLQRANNSDTGFGFSVRGDAPVIVASVDSGSLAQFGGMKDGDFIVAIGDRDVKWSPHEEVVQLIKDAGKCLSLKLVTPMHKNNNVHHSHNSRIKGTESIKESKTSEKNQSPSSSITPSRKQIWNPFKKHQRDHELCYNHMTTT
ccccHHHHHHHHHHHHcccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccccEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHcHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHccccccccccccHHHHccccccccccEEEEccccEEEEEEccccHHHHcccccccEEEEEcccccccccHHHHHHHHHHccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccHHHHHHHHHHHHHHHHHHHHcccHHHHccccHHHHHHEEEEHHHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccHcccccccccccccccccccccccccccccHHHHHHcccEHHcHHccccccccEEEEEccccccccEEEEEccccEEEEEEccccHHHHcccccccEEEEEcccccccccHHHHHHHHHHccccEEEEEEEcccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccc
MVAGRSQQRAIAQMVTYGDSKHNQRNVAQLQATTNRKLKETVALELSFVNSNLQLLKEQLAELNSSVElyqndkrsldSVESVYRLFSLMILFMLstrdrktprsfkyfskepvmpmiplglketkeidvrePFKDFILEhysedgtayeDSVSEFMDMRqamrtpnrdnsgISLLFQYYNQLYFIerrffppdrslgiyfeydsltgvpscqrTIAFEKACVLFNMAAIYTQMAAKQDRLTSTGLDQAVDNFLRAAGTFTYlqenftnapsmdlgppMLDMLIQLMLAQARECLFQKLQLQTTEKCDFQHMLELAQEAAQVAEVYMSLLSLitvpevkdyvpLSWVSLIQVKKEHYLALSHYYCASGLLTKSLANLSSTAQTVLSYLHipqenkknlilefepedesQRKQLGVAHLRSALLFHEESQRIYRMCRELRNKQALFQVLVQAHTLTLEmyadveeedefntmyeapnitpstkfqltltppdfahlpvedLFKQLGPVAIFsakhhwtaprsiqlqrannsdtgfgfsvrgdapvivasvdsgslaqfggmkdgdFIVAIgdrdvkwsphEEVVQLIKDAGKClslklvtpmhknnnvhhshnsrikgtesikesktseknqspsssitpsrkqiwnpfkkhqrdhelcynhmttt
mvagrsqqRAIAQMVtygdskhnqRNVAQLQATTNRKLKETVALELSFVNSNLQLLKEQLAELNSSVelyqndkrsldSVESVYRLFSLMILfmlstrdrktprsfkyfskepvmpmiplglketkeiDVREPFKDFILEHYSEDGTAYEDSVSEFMDMRQAMRtpnrdnsgiSLLFQYYNQLYFIERRFFPPDRSLGIYFEYDSLTGVPSCQRTIAFEKACVLFNMAAIYTQMAAKQDRLTSTGLDQAVDNFLRAAGTFTYLQENFTNAPSMDLGPPMLDMLIQLMLAQARECLFQKLQLQTTEKCDFQHMLELAQEAAQVAEVYMSLLSLITVPEVKDYVPLSWVSLIQVKKEHYLALSHYYCASGLLTKSLANLSSTAQTVLSYLHIPQENKKNLILEFEPEDESQRKQLGVAHLRSALLFHEESQRIYRMCRELRNKQALFQVLVQAHTLTLEMYADVEEEDEFNTMYEAPNITPSTKFQLTLTPPDFAHLPVEDLFKQLGPVAIFSAKHHWTAPRSIQLQRANNSDTGFGFSVRGDAPVIVASVDSGSLAQFGGMKDGDFIVAIGDRDVKWSPHEEVVQLIKDAGKCLSLKLVTpmhknnnvhhshnsrikgtesikesktseknqspsssitpsrkqiwnpfkkhqrdhelcynhmttt
MVAGRSQQRAIAQMVTYGDSKHNQRNVAQLQATTNRKLKETVALELSFVNSNLQLLKEQLAELNSSVELYQNDKRSLDSVESVYRLFSLMILFMLSTRDRKTPRSFKYFSKEPVMPMIPLGLKETKEIDVREPFKDFILEHYSEDGTAYEDSVSEFMDMRQAMRTPNRDNSGISLLFQYYNQLYFIERRFFPPDRSLGIYFEYDSLTGVPSCQRTIAFEKACVLFNMAAIYTQMAAKQDRLTSTGLDQAVDNFLRAAGTFTYLQENFTNAPSMDLGPPMLDMLIQLMLAQARECLFQKLQLQTTEKCDFQHMlelaqeaaqvaevYMSLLSLITVPEVKDYVPLSWVSLIQVKKEHYLALSHYYCASGLLTKSLANLSSTAQTVLSYLHIPQENKKNLILEFEPEDESQRKQLGVAHLRSALLFHEESQRIYRMCRELRNKQALFQVLVQAHTLTLEMYADVEEEDEFNTMYEAPNITPSTKFQLTLTPPDFAHLPVEDLFKQLGPVAIFSAKHHWTAPRSIQLQRANNSDTGFGFSVRGDAPVIVASVDSGSLAQFGGMKDGDFIVAIGDRDVKWSPHEEVVQLIKDAGKCLSLKLVTPMhknnnvhhshnsRIKGTESIKESKTSEKNQSPSSSITPSRKQIWNPFKKHQRDHELCYNHMTTT
*************************************LKETVALELSFVNSNLQLLKEQLAELNSSVELYQNDKRSLDSVESVYRLFSLMILFMLSTRDRKTPRSFKYFSKEPVMPMIPLGLKETKEIDVREPFKDFILEHYSED**************************GISLLFQYYNQLYFIERRFFPPDRSLGIYFEYDSLTGVPSCQRTIAFEKACVLFNMAAIYTQMAAKQDRLTSTGLDQAVDNFLRAAGTFTYLQENFTNAPSMDLGPPMLDMLIQLMLAQARECLFQKLQLQTTEKCDFQHMLELAQEAAQVAEVYMSLLSLITVPEVKDYVPLSWVSLIQVKKEHYLALSHYYCASGLLTKSLANLSSTAQTVLSYLHIPQENKKNLILE***********LGVAHLRSALLFHEESQRIYRMCRELRNKQALFQVLVQAHTLTLEMYADVEEEDEFNTMYEAPNITPSTKFQLTLTPPDFAHLPVEDLFKQLGPVAIFSAKHHWTAPRSIQLQRANNSDTGFGFSVRGDAPVIVASVDSGSLAQFGGMKDGDFIVAIGDRDVKWSPHEEVVQLIKDAGKCLSLKLVTP*****************************************************************
**********************************NRKLKETVALELSFVNSNLQLLKEQLAELNSSVE************ESVYRLFSLMILFM**************FSKEPVMPMIPLGLKETKEIDVREPFKDFILEHYSEDGTAYEDSVSEFMDMRQA*********GISLLFQYYNQLYFIERRFFPPDRSLGIYFEYDSLTGVPSCQRTIAFEKACVLFNMAAIYTQMAAK*****STGLDQAVDNFLRAAGTFTYLQENFTNAPSMDLGPPMLDMLIQLMLAQARECLFQKLQLQ*********MLELAQEAAQVAEVYMSLLSLITVPEVKDYVPLSWVSLIQVKKEHYLALSHYYCASGLLTKSLA**********SYL*IP*********************LGVAHLRSALLFHEESQRIYRMCRELRNKQALFQVLVQAHTLTLEMYADVEEEDEFNTMYEA****************DFAHLPVEDLFKQLGPVAIFSAKHHWTAPRSIQLQRANNSDTGFGFSVRGDAPVIVASVDSGSLAQFGGMKDGDFIVAIGDRDVKWSPHEEVVQLIKDAGKCLSLKLV*******************************************************************
**********IAQMVTYGDSKHNQRNVAQLQATTNRKLKETVALELSFVNSNLQLLKEQLAELNSSVELYQNDKRSLDSVESVYRLFSLMILFMLSTRDRKTPRSFKYFSKEPVMPMIPLGLKETKEIDVREPFKDFILEHYSEDGTAYEDSVSEFMDMRQAMRTPNRDNSGISLLFQYYNQLYFIERRFFPPDRSLGIYFEYDSLTGVPSCQRTIAFEKACVLFNMAAIYTQMAAKQDRLTSTGLDQAVDNFLRAAGTFTYLQENFTNAPSMDLGPPMLDMLIQLMLAQARECLFQKLQLQTTEKCDFQHMLELAQEAAQVAEVYMSLLSLITVPEVKDYVPLSWVSLIQVKKEHYLALSHYYCASGLLTKSLANLSSTAQTVLSYLHIPQENKKNLILEFEPEDESQRKQLGVAHLRSALLFHEESQRIYRMCRELRNKQALFQVLVQAHTLTLEMYADVEEEDEFNTMYEAPNITPSTKFQLTLTPPDFAHLPVEDLFKQLGPVAIFSAKHHWTAPRSIQLQRANNSDTGFGFSVRGDAPVIVASVDSGSLAQFGGMKDGDFIVAIGDRDVKWSPHEEVVQLIKDAGKCLSLKLVTPMHKNNNVH********************************RKQIWNPFKKHQRDHELCYNHMTTT
*****SQQRAIAQMVTYGDSKHNQRNVAQLQATTNRKLKETVALELSFVNSNLQLLKEQLAELNSSVELYQNDKRSLDSVESVYRLFSLMILFMLSTRD************EPVMPMIPLGLKETKEIDVREPFKDFILEHYSEDGTAYEDSVSEFMDMRQAMRTPNRDNSGISLLFQYYNQLYFIERRFFPPDRSLGIYFEYDSLTGVPSCQRTIAFEKACVLFNMAAIYTQMAAKQDRLTSTGLDQAVDNFLRAAGTFTYLQENFTNAPSMDLGPPMLDMLIQLMLAQARECLFQKLQLQTTEKCDFQHMLELAQEAAQVAEVYMSLLSLITVPEVKDYVPLSWVSLIQVKKEHYLALSHYYCASGLLTKSLANLSSTAQTVLSYLHIPQENKKNLILEFEPEDESQRKQLGVAHLRSALLFHEESQRIYRMCRELRNKQALFQVLVQAHTLTLEMYADVEEEDEFNTMYEAPNITPSTKFQLTLTPPDFAHLPVEDLFKQLGPVAIFSAKHHWTAPRSIQLQRANNSDTGFGFSVRGDAPVIVASVDSGSLAQFGGMKDGDFIVAIGDRDVKWSPHEEVVQLIKDAGKCLSLKLVTPMH***************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVAGRSQQRAIAQMVTYGDSKHNQRNVAQLQATTNRKLKETVALExxxxxxxxxxxxxxxxxxxxxxxxxxxxKRSLDSVESVYRLFSLMILFMLSTRDRKTPRSFKYFSKEPVMPMIPLGLKETKEIDVREPFKDFILEHYSEDGTAYEDSVSEFMDMRQAMRTPNRDNSGISLLFQYYNQLYFIERRFFPPDRSLGIYFEYDSLTGVPSCQRTIAFEKACVLFNMAAIYTQMAAKQDRLTSTGLDQAVDNFLRAAGTFTYLQENFTNAPSMDLGPPMLDMLIQLMLAQARECLFQKLQLQTTEKCDFQHMLELAQEAAQVAEVYMSLLSLITVPEVKDYVPLSWVSLIQVKKEHYLALSHYYCASGLLTKSLANLSSTAQTVLSYLHIPQENKKNLILEFEPEDESQRKQLGVAHLRSALLFHEESQRIYRMCRELRNKQALFQVLVQAHTLTLEMYADVEEEDEFNTMYEAPNITPSTKFQLTLTPPDFAHLPVEDLFKQLGPVAIFSAKHHWTAPRSIQLQRANNSDTGFGFSVRGDAPVIVASVDSGSLAQFGGMKDGDFIVAIGDRDVKWSPHEEVVQLIKDAGKCLSLKLVTPMHKNNNVHHSHNSRIKGTESIKESKTSEKNQSPSSSITPSRKQIWNPFKKHQRDHELCYNHMTTT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query665 2.2.26 [Sep-21-2011]
Q63ZR5683 Rhophilin-2-B OS=Xenopus N/A N/A 0.855 0.833 0.388 1e-122
Q8IUC4686 Rhophilin-2 OS=Homo sapie yes N/A 0.806 0.781 0.409 1e-122
Q6DJJ6683 Rhophilin-2-A OS=Xenopus N/A N/A 0.778 0.758 0.407 1e-121
Q8BWR8686 Rhophilin-2 OS=Mus muscul no N/A 0.806 0.781 0.406 1e-120
A4FUC9686 Rhophilin-2 OS=Bos taurus no N/A 0.804 0.779 0.408 1e-120
Q8HXG3686 Rhophilin-2 OS=Canis fami yes N/A 0.806 0.781 0.412 1e-119
Q6TNR1683 Rhophilin-2 OS=Danio reri no N/A 0.795 0.774 0.409 1e-117
Q61085643 Rhophilin-1 OS=Mus muscul yes N/A 0.763 0.790 0.414 1e-115
Q8TCX5695 Rhophilin-1 OS=Homo sapie no N/A 0.789 0.755 0.4 1e-106
A8MT19583 Putative rhophilin-2-like no N/A 0.741 0.845 0.363 2e-88
>sp|Q63ZR5|RHN2B_XENLA Rhophilin-2-B OS=Xenopus laevis GN=rhpn2-b PE=2 SV=1 Back     alignment and function desciption
 Score =  440 bits (1132), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 244/628 (38%), Positives = 374/628 (59%), Gaps = 59/628 (9%)

Query: 4   GRSQ---QRAI--AQMVTYGDSKHNQRNVAQLQATTNRKLKETVALELSFVNSNLQLLKE 58
           GRS+   QRAI   Q++     +    N+  L+AT N K++E V LELSFVNSNLQ LKE
Sbjct: 31  GRSKLQNQRAILNQQILKAMRMRAGAENL--LRATANNKIREQVLLELSFVNSNLQRLKE 88

Query: 59  QLAELNSSVELYQNDKRSLDSVESVYRLFSLMILFMLSTRDRKTPRSFKYFSKEPVMPMI 118
           +L  LN SVE+YQ+ +++ +                                    +P+I
Sbjct: 89  ELERLNISVEVYQHTEQASN------------------------------------IPLI 112

Query: 119 PLGLKETKEIDVREPFKDFILEHYSEDGTAYEDSVSEFMDMRQAMRTPNRDNSGISLLFQ 178
           PLGLKETK++D    FKDFILEHYSED + YE+ +++ MD+RQA RTP+RD +G+ LL  
Sbjct: 113 PLGLKETKDVDFTTAFKDFILEHYSEDASEYENELADLMDLRQACRTPSRDEAGVELLVS 172

Query: 179 YYNQLYFIERRFFPPDRSLGIYFE-YDSLTGVPSCQRTIAFEKACVLFNMAAIYTQMAAK 237
           Y+ QL ++E RFFPP R++GI F  YDS TGVP  Q  I+ EKA +LFN+AA+Y+Q+  +
Sbjct: 173 YFQQLGYLENRFFPPSRNIGILFTWYDSFTGVPVSQPNISLEKASILFNIAALYSQIGTR 232

Query: 238 QDRLTSTGLDQAVDNFLRAAGTFTYLQENFTNAPSMDLGPPMLDMLIQLMLAQARECLFQ 297
            +R T  GL++AV  F +AAG   YL+E FT+ PS D+ P ML  LI+++LA+A EC F+
Sbjct: 233 CNRQTKIGLEEAVTTFQKAAGVLNYLKETFTHTPSYDMSPAMLGALIKMLLAEAHECYFE 292

Query: 298 KLQLQTTEKCDFQHMLELAQEAAQVAEVYMSLLSLITVPEVKDYVPLSWVSLIQVKKEHY 357
           K+ L   +  +F  +L+ AQEAA+V+EV+M + +L+    +K+ VP SW  ++QVK EHY
Sbjct: 293 KMILSGIQN-EFCTLLKAAQEAAKVSEVHMQVYTLMNQAPIKENVPYSWSVMVQVKAEHY 351

Query: 358 LALSHYYCASGLLTKSLANLS---STAQTVLSYLH--IPQENKKNLILEFEPEDESQRKQ 412
            AL++Y+ A  L+   L NLS      +  +S L+  +P+      IL    +D+ QR  
Sbjct: 352 KALANYFVAITLIDYQL-NLSDDEDKQEKAISQLYDSMPEGLTAQTIL----KDQQQRTL 406

Query: 413 LGVAHLRSALLFHEESQRIYRMCRELRNKQALFQVLVQAHTLTLEMYADVEEEDEFNTMY 472
           LG AHL  A+  HEE+ R   +C  LR    L  +L   H  +L  ++  ++ D+F  + 
Sbjct: 407 LGKAHLSKAIRSHEEAIRFSTLCSTLRQIDVLQLILSAFHQRSLLKFSQHQKPDDFLDLL 466

Query: 473 EAPNITPSTKFQLTLTPPDFAHLPVEDLFKQLGPVAIFSAKHHWTAPRSIQLQRANNSDT 532
            AP+I   T++Q    PP  +   V D+F++LGP++IFS K  W+APR + + +    D 
Sbjct: 467 SAPDIVSKTEYQAETIPPQLSKDKVTDIFQRLGPLSIFSVKQRWSAPRKMCITK---EDG 523

Query: 533 GFGFSVRGDAPVIVASVDSGSLAQFGGMKDGDFIVAIGDRDVKWSPHEEVVQLIKDAGK- 591
            FGF ++GD PV V S+D    A   G+K+GD+IV++  +D KW    +V+ ++++ G+ 
Sbjct: 524 DFGFVLKGDCPVQVISLDPLCPAATEGLKEGDYIVSVAGKDCKWCSTSQVMDMLQETGQD 583

Query: 592 CLSLKLVTPMHKNNNVHHSHNSRIKGTE 619
            + +++++   + N++ +   +   G +
Sbjct: 584 SIEIQVISIQDQTNSLANKSATYYAGMQ 611
Binds specifically to GTP-Rho.
Xenopus laevis (taxid: 8355)
>sp|Q8IUC4|RHPN2_HUMAN Rhophilin-2 OS=Homo sapiens GN=RHPN2 PE=1 SV=1 Back     alignment and function description
>sp|Q6DJJ6|RHN2A_XENLA Rhophilin-2-A OS=Xenopus laevis GN=rhpn2-a PE=2 SV=1 Back     alignment and function description
>sp|Q8BWR8|RHPN2_MOUSE Rhophilin-2 OS=Mus musculus GN=Rhpn2 PE=1 SV=2 Back     alignment and function description
>sp|A4FUC9|RHPN2_BOVIN Rhophilin-2 OS=Bos taurus GN=RHPN2 PE=2 SV=1 Back     alignment and function description
>sp|Q8HXG3|RHPN2_CANFA Rhophilin-2 OS=Canis familiaris GN=RHPN2 PE=2 SV=1 Back     alignment and function description
>sp|Q6TNR1|RHPN2_DANRE Rhophilin-2 OS=Danio rerio GN=rhpn2 PE=2 SV=1 Back     alignment and function description
>sp|Q61085|RHPN1_MOUSE Rhophilin-1 OS=Mus musculus GN=Rhpn1 PE=1 SV=2 Back     alignment and function description
>sp|Q8TCX5|RHPN1_HUMAN Rhophilin-1 OS=Homo sapiens GN=RHPN1 PE=2 SV=1 Back     alignment and function description
>sp|A8MT19|RHN2P_HUMAN Putative rhophilin-2-like protein RHPN2P1 OS=Homo sapiens GN=RHPN2P1 PE=5 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query665
91085665660 PREDICTED: similar to rhophilin [Triboli 0.806 0.812 0.635 0.0
270010028663 hypothetical protein TcasGA2_TC009368 [T 0.806 0.808 0.635 0.0
332030731644 Rhophilin-2 [Acromyrmex echinatior] 0.876 0.905 0.591 0.0
340708836654 PREDICTED: rhophilin-2-like [Bombus terr 0.894 0.909 0.576 0.0
307176413716 Rhophilin-2 [Camponotus floridanus] 0.870 0.808 0.583 0.0
345479537716 PREDICTED: rhophilin-2-like isoform 1 [N 0.894 0.831 0.591 0.0
345479539665 PREDICTED: rhophilin-2-like isoform 4 [N 0.894 0.894 0.591 0.0
345479535654 PREDICTED: rhophilin-2-like isoform 3 [N 0.894 0.909 0.591 0.0
345479533690 PREDICTED: rhophilin-2-like isoform 2 [N 0.882 0.850 0.598 0.0
427797123656 Putative rhophilin, partial [Rhipicephal 0.813 0.824 0.559 0.0
>gi|91085665|ref|XP_971529.1| PREDICTED: similar to rhophilin [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/576 (63%), Positives = 433/576 (75%), Gaps = 40/576 (6%)

Query: 30  LQATTNRKLKETVALELSFVNSNLQLLKEQLAELNSSVELYQNDKRSLDSVESVYRLFSL 89
            +ATTNRKLKETVALELSFVNSNLQLLKEQLAELNSSVELYQ+D                
Sbjct: 59  FKATTNRKLKETVALELSFVNSNLQLLKEQLAELNSSVELYQSD---------------- 102

Query: 90  MILFMLSTRDRKTPRSFKYFSKEPVMPMIPLGLKETKEIDVREPFKDFILEHYSEDGTAY 149
                               S + VMPMIPLGLKETKEID R+PFKDFILEHYSED   Y
Sbjct: 103 --------------------STDAVMPMIPLGLKETKEIDFRDPFKDFILEHYSEDANQY 142

Query: 150 EDSVSEFMDMRQAMRTPNRDNSGISLLFQYYNQLYFIERRFFPPDRSLGIYFE-YDSLTG 208
           ED++++FMD RQA+RTP RD +GISLLF+YYNQLYF+ERRFFPPDRSLGIYFE +DSLTG
Sbjct: 143 EDAIADFMDTRQAIRTPLRDTTGISLLFRYYNQLYFVERRFFPPDRSLGIYFEWFDSLTG 202

Query: 209 VPSCQRTIAFEKACVLFNMAAIYTQMAAKQDRLTSTGLDQAVDNFLRAAGTFTYLQENFT 268
           VPSCQRT+AFEKACVLFNM AIYTQ+ AKQDR T+ GLD AVD+FLRAAGTF Y+ ENFT
Sbjct: 203 VPSCQRTVAFEKACVLFNMGAIYTQIGAKQDRSTAKGLDAAVDSFLRAAGTFRYIHENFT 262

Query: 269 NAPSMDLGPPMLDMLIQLMLAQARECLFQKLQLQTTEKCDFQHMLELAQEAAQVAEVYMS 328
           NAPSMDLGP ML+ML+QLMLAQARECL +KL LQ+ E       L+LAQEAA +A+ Y  
Sbjct: 263 NAPSMDLGPEMLEMLVQLMLAQARECLLEKLDLQSKESRSIDICLDLAQEAAHLADCYSQ 322

Query: 329 LLSLITVPEVKDYVPLSWVSLIQVKKEHYLALSHYYCASGLLTKSLANLSSTAQTVLSYL 388
           +  LI    V DYVP SW+SL+QVKKE+Y  ++HY+ ASG+L K  A +S T +T L +L
Sbjct: 323 VYQLIMTESVHDYVPYSWISLVQVKKEYYTGMAHYHVASGVLHKEAAKMSPTTKTTLQFL 382

Query: 389 HIPQENKKNLILEFEPEDESQRKQLGVAHLRSALLFHEESQRIYRMCRELRNKQALFQVL 448
           H  +     L +   P+D+++R+ LG AHLR +L+ HEE QR++RMCRELR KQAL  VL
Sbjct: 383 H-AETASTQLDIRL-PKDDAERRLLGRAHLRESLVLHEECQRLHRMCRELRGKQALTAVL 440

Query: 449 VQAHTLTLEMYADVEEEDEFNTMYEAPNITPSTKFQLTLTPPDFAHLPVEDLFKQLGPVA 508
             AH   L+ Y + E ED+F+ + + P +  +TKFQL LTPPDFA   V DLF+ LGP+A
Sbjct: 441 RNAHKTALQAYTNNENEDDFSDVLDPPRVQAATKFQLALTPPDFAQYRVNDLFRALGPIA 500

Query: 509 IFSAKHHWTAPRSIQLQRANNSDTGFGFSVRGDAPVIVASVDSGSLAQFGGMKDGDFIVA 568
           IFSAK HWTAPR +QL R   S+ GFGFSVRGDAPVIVA V+S SLA+FGG+K+GDFIVA
Sbjct: 501 IFSAKRHWTAPRLVQLHRGRTSE-GFGFSVRGDAPVIVAIVESNSLAEFGGVKEGDFIVA 559

Query: 569 IGDRDVKWSPHEEVVQLIKDAGKCLSLKLVTPMHKN 604
           I D+DVKWS H+EVV LIK+AG  LSLKLVTPM +N
Sbjct: 560 ISDKDVKWSSHDEVVALIKNAGDSLSLKLVTPMDRN 595

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|270010028|gb|EFA06476.1| hypothetical protein TcasGA2_TC009368 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|332030731|gb|EGI70407.1| Rhophilin-2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340708836|ref|XP_003393025.1| PREDICTED: rhophilin-2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307176413|gb|EFN65987.1| Rhophilin-2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|345479537|ref|XP_001607370.2| PREDICTED: rhophilin-2-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345479539|ref|XP_003423971.1| PREDICTED: rhophilin-2-like isoform 4 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345479535|ref|XP_003423970.1| PREDICTED: rhophilin-2-like isoform 3 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345479533|ref|XP_003423969.1| PREDICTED: rhophilin-2-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|427797123|gb|JAA64013.1| Putative rhophilin, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query665
UNIPROTKB|F1NY89576 RHPN1 "Uncharacterized protein 0.706 0.815 0.459 6.8e-132
ZFIN|ZDB-GENE-081031-79658 rhpn1 "rhophilin, Rho GTPase b 0.714 0.721 0.444 6.3e-127
UNIPROTKB|F1NFZ9683 RHPN2 "Uncharacterized protein 0.703 0.685 0.445 5.1e-123
FB|FBgn0026374718 Rhp "Rhophilin" [Drosophila me 0.741 0.686 0.435 6.5e-123
UNIPROTKB|F1N4C8662 RHPN1 "Uncharacterized protein 0.795 0.799 0.396 9e-111
ZFIN|ZDB-GENE-030131-9927683 rhpn2 "rhophilin, Rho GTPase b 0.721 0.702 0.398 1.3e-109
UNIPROTKB|Q8IUC4686 RHPN2 "Rhophilin-2" [Homo sapi 0.717 0.695 0.417 7.1e-109
RGD|1308366686 Rhpn2 "rhophilin, Rho GTPase b 0.720 0.698 0.408 3.1e-108
UNIPROTKB|Q8HXG3686 RHPN2 "Rhophilin-2" [Canis lup 0.717 0.695 0.421 6.4e-108
UNIPROTKB|A4FUC9686 RHPN2 "Rhophilin-2" [Bos tauru 0.717 0.695 0.413 2.1e-107
UNIPROTKB|F1NY89 RHPN1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 1144 (407.8 bits), Expect = 6.8e-132, Sum P(2) = 6.8e-132
 Identities = 221/481 (45%), Positives = 322/481 (66%)

Query:   115 MPMIPLGLKETKEIDVREPFKDFILEHYSEDGTAYEDSVSEFMDMRQAMRTPNRDNSGIS 174
             +PMIPLGLKETKE+D+  P KDFI EHY E+G  +E  + EFM++RQAMRTP+R+ +G+ 
Sbjct:    86 VPMIPLGLKETKELDLLVPLKDFISEHYGEEGVMFEKEIKEFMELRQAMRTPSRNEAGLE 145

Query:   175 LLFQYYNQLYFIERRFFPPDRSLGIYFE-YDSLTGVPSCQRTIAFEKACVLFNMAAIYTQ 233
             LL +YYNQLYF++ RFFPP +SLG++F  YDSLTGVPS QR +AFEK  VLFN+ A++TQ
Sbjct:   146 LLMEYYNQLYFLDSRFFPPSKSLGVFFHWYDSLTGVPSHQRALAFEKGSVLFNIGALHTQ 205

Query:   234 MAAKQDRLTSTGLDQAVDNFLRAAGTFTYLQENFTNAPSMDLGPPMLDMLIQLMLAQARE 293
             + A+QDR +  GL+QA+D F +AAG F YL+ENF+NAPS+D+    L+ML++LM+AQ +E
Sbjct:   206 IGARQDRASLPGLNQAIDAFQKAAGAFNYLKENFSNAPSLDMSTASLNMLVRLMVAQVQE 265

Query:   294 CLFQKLQLQTTEKCDFQHMXXXXXXXXXXXXXYMSLLSLITVPEVKDYVPLSWVSLIQVK 353
             C+F+K+ L  T+K DF                Y  +   +T   VKDYVP SW +++ VK
Sbjct:   266 CVFEKVTLLHTQK-DFFSWLQLAQEAARVEDVYSLVHQTMTQAHVKDYVPFSWTTMVHVK 324

Query:   354 KEHYLALSHYYCASGLLTKSLANLSSTAQTVLSYL--HIPQENKKNL-ILEFEPEDESQR 410
              EH+ ALSHY+ A  L    +A+ +   +   ++L  HI      +L +L  +PE+   R
Sbjct:   325 SEHFKALSHYFAAIALCDCPVASDAELPEHEKAFLQFHITMPEGPSLRVLLQDPEE---R 381

Query:   411 KQLGVAHLRSALLFHEESQRIYRMCRELRNKQALFQVLVQAHTLTLEMYADVEEEDEFNT 470
             ++LG AHL+ A++ HEE+ RI+ +C+ LR    L +VL  AH  +L  Y++++ E++F  
Sbjct:   382 RKLGKAHLKKAIMKHEEAMRIHGLCKILRKMDILQEVLSFAHKRSLSKYSEIDHEEDFFE 441

Query:   471 MYEAPNITPSTKFQLTLTPPDFAHLPVEDLFKQLGPVAIFSAKHHWTAPRSIQLQRANNS 530
               +AP+I P T  +  +  P F+ + V DLF +LGP+++FSAK+ W   R + L R  N 
Sbjct:   442 TGDAPDIHPKTHQKPEIKSPSFSQVKVTDLFHRLGPLSVFSAKNKWYPMRRVHLMRGEN- 500

Query:   531 DTGFGFSVRGDAPVIVASVDSGSLAQFGGMKDGDFIVAIGDRDVKWSPHEEVVQLIKDAG 590
               GFGF++RGD+PV++A V  G  A   G+K+GD+I+ +  +D +WS H EVVQL+K  G
Sbjct:   501 --GFGFTLRGDSPVLIAGVIPGGCAAEAGLKEGDYIILVNGKDCRWSKHAEVVQLLKSTG 558

Query:   591 K 591
             +
Sbjct:   559 E 559
GO:0005622 "intracellular" evidence=IEA
GO:0007165 "signal transduction" evidence=IEA
GO:0005083 "small GTPase regulator activity" evidence=IEA
ZFIN|ZDB-GENE-081031-79 rhpn1 "rhophilin, Rho GTPase binding protein 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NFZ9 RHPN2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0026374 Rhp "Rhophilin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1N4C8 RHPN1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-9927 rhpn2 "rhophilin, Rho GTPase binding protein 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IUC4 RHPN2 "Rhophilin-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1308366 Rhpn2 "rhophilin, Rho GTPase binding protein 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q8HXG3 RHPN2 "Rhophilin-2" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A4FUC9 RHPN2 "Rhophilin-2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q61085RHPN1_MOUSENo assigned EC number0.41430.76390.7900yesN/A
Q8IUC4RHPN2_HUMANNo assigned EC number0.40950.80600.7813yesN/A
Q8HXG3RHPN2_CANFANo assigned EC number0.41290.80600.7813yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query665
cd09244350 cd09244, BRO1_Rhophilin, Protein-interacting Bro1- 0.0
cd09248384 cd09248, BRO1_Rhophilin_1, Protein-interacting Bro 1e-134
cd09249385 cd09249, BRO1_Rhophilin_2, Protein-interacting Bro 1e-127
smart01041381 smart01041, BRO1, BRO1-like domain 1e-111
pfam03097374 pfam03097, BRO1, BRO1-like domain 1e-106
cd09242348 cd09242, BRO1_ScBro1_like, Protein-interacting, N- 9e-55
cd09034345 cd09034, BRO1_Alix_like, Protein-interacting Bro1- 5e-47
cd09239361 cd09239, BRO1_HD-PTP_like, Protein-interacting, N- 4e-39
cd09246353 cd09246, BRO1_Alix_like_1, Protein-interacting, N- 8e-39
cd09240346 cd09240, BRO1_Alix, Protein-interacting, N-termina 2e-36
cd09241355 cd09241, BRO1_ScRim20-like, Protein-interacting, N 3e-36
cd1163385 cd11633, HR1_Rhophilin-1, Protein kinase C-related 1e-19
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 2e-18
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 1e-14
cd1162476 cd11624, HR1_Rhophilin, Protein kinase C-related k 2e-13
cd1163482 cd11634, HR1_Rhophilin-2, Protein kinase C-related 6e-13
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 6e-10
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 6e-10
cd0098790 cd00987, PDZ_serine_protease, PDZ domain of tryspi 2e-05
cd09243353 cd09243, BRO1_Brox_like, Protein-interacting Bro1- 6e-05
pfam0218560 pfam02185, HR1, Hr1 repeat 2e-04
cd0098979 cd00989, PDZ_metalloprotease, PDZ domain of bacter 2e-04
pfam1318081 pfam13180, PDZ_2, PDZ domain 5e-04
TIGR02037428 TIGR02037, degP_htrA_DO, periplasmic serine protea 0.002
cd0098885 cd00988, PDZ_CTP_protease, PDZ domain of C-termina 0.002
>gnl|CDD|185767 cd09244, BRO1_Rhophilin, Protein-interacting Bro1-like domain of RhoA-binding protein Rhophilin and related domains Back     alignment and domain information 
 Score =  534 bits (1379), Expect = 0.0
 Identities = 220/386 (56%), Positives = 273/386 (70%), Gaps = 37/386 (9%)

Query: 117 MIPLGLKETKEIDVREPFKDFILEHYSEDGTAYEDSVSEFMDMRQAMRTPNRDNSGISLL 176
           MIPLGLKETKEID  EPFKDFILEHYSED + YED +++F D+RQAMRTP+RD +GI LL
Sbjct: 1   MIPLGLKETKEIDFMEPFKDFILEHYSEDPSLYEDEIADFTDLRQAMRTPSRDEAGIELL 60

Query: 177 FQYYNQLYFIERRFFPPDRSLGIYFE-YDSLTGVPSCQRTIAFEKACVLFNMAAIYTQMA 235
           F+YYNQLYF+ERRFFPPDRSLGIYF  YDSLTGVPS QR++AFEKA VLFN+ A+YTQ+ 
Sbjct: 61  FEYYNQLYFVERRFFPPDRSLGIYFHWYDSLTGVPSVQRSVAFEKASVLFNIGALYTQIG 120

Query: 236 AKQDRLTSTGLDQAVDNFLRAAGTFTYLQENFTNAPSMDLGPPMLDMLIQLMLAQARECL 295
           AKQDR T  G++ AVD F RAAG F YL+ENF+NAPSMDL P ML+ LI+LMLAQA+EC+
Sbjct: 121 AKQDRTTEEGIEAAVDAFQRAAGAFNYLRENFSNAPSMDLSPEMLEALIKLMLAQAQECV 180

Query: 296 FQKLQLQTTEKCDFQHMLELAQEAAQVAEVYMSLLSLITVPEVKDYVPLSWVSLIQVKKE 355
           F+KL L   +  D Q  L+LAQEAAQV++ Y  +  L+    VKDY+P SW+SL++VK E
Sbjct: 181 FEKLVLPGEDSKDIQACLDLAQEAAQVSDCYSEVHKLMNQEPVKDYIPYSWISLVEVKSE 240

Query: 356 HYLALSHYYCASGLLTKSLANLSSTAQTVLSYLHIPQENKKNLILEFEPEDESQRKQLGV 415
           HY AL+HYY A GLL                                      +R+ LG 
Sbjct: 241 HYKALAHYYAAMGLL------------------------------------LEERRLLGK 264

Query: 416 AHLRSALLFHEESQRIYRMCRELRNKQALFQVLVQAHTLTLEMYADVEEEDEFNTMYEAP 475
           AHL+ ALL HEE+ R++RMCR LRN  +L +VL +AH  +L  Y+ +EEED+F+   +AP
Sbjct: 265 AHLKEALLLHEEALRLHRMCRFLRNVDSLQEVLKEAHDRSLNKYSSLEEEDDFSDALDAP 324

Query: 476 NITPSTKFQLTLTPPDFAHLPVEDLF 501
           +I   TK QL + PPDF  + V+DLF
Sbjct: 325 DIQAKTKQQLEIIPPDFTQVKVKDLF 350

This family contains the Bro1-like domain of RhoA-binding proteins, Rhophilin-1 and -2, and related domains. It belongs to the BRO1_Alix_like superfamily which also includes the Bro1-like domains of mammalian Alix (apoptosis-linked gene-2 interacting protein X), His-Domain type N23 protein tyrosine phosphatase (HD-PTP, also known as PTPN23), Brox, Bro1 and Rim20 (also known as PalA) from Saccharomyces cerevisiae, Ustilago maydis Rim23 (also known as PalC), and related domains. Rhophilin-1 and -2 bind both GDP- and GTP-bound RhoA. Bro1-like domains are boomerang-shaped, and part of the domain is a tetratricopeptide repeat (TPR)-like structure. In addition to this Bro1-like domain, Rhophilin-1 and -2, contain an N-terminal Rho-binding domain and a C-terminal PDZ (PS.D.-95, Disc-large, ZO-1) domain. Their PDZ domains have limited homology. Rhophilin-1 and -2 have different activities. The Drosophila knockout of Rhophilin-1 is embryonic lethal, suggesting an essential role in embryonic development. Roles of Rhophilin-2 may include limiting stress fiber formation or increasing the turnover of F-actin in the absence of high levels of RhoA signaling activity. The isolated Bro1-like domain of Rhophilin-1 binds human immunodeficiency virus type 1 (HIV-1) nucleocapsid. This family lacks the V-shaped (V) domain found in many members of the BRO1_Alix _like superfamily. Length = 350
>gnl|CDD|185771 cd09248, BRO1_Rhophilin_1, Protein-interacting Bro1-like domain of RhoA-binding protein Rhophilin-1 Back     alignment and domain information
>gnl|CDD|185772 cd09249, BRO1_Rhophilin_2, Protein-interacting Bro1-like domain of RhoA-binding protein Rhophilin-2 Back     alignment and domain information
>gnl|CDD|214990 smart01041, BRO1, BRO1-like domain Back     alignment and domain information
>gnl|CDD|217365 pfam03097, BRO1, BRO1-like domain Back     alignment and domain information
>gnl|CDD|185765 cd09242, BRO1_ScBro1_like, Protein-interacting, N-terminal, Bro1-like domain of Saccharomyces cerevisiae Bro1 and related proteins Back     alignment and domain information
>gnl|CDD|185761 cd09034, BRO1_Alix_like, Protein-interacting Bro1-like domain of mammalian Alix and related domains Back     alignment and domain information
>gnl|CDD|185762 cd09239, BRO1_HD-PTP_like, Protein-interacting, N-terminal, Bro1-like domain of mammalian His-Domain type N23 protein tyrosine phosphatase and related domains Back     alignment and domain information
>gnl|CDD|185769 cd09246, BRO1_Alix_like_1, Protein-interacting, N-terminal, Bro1-like domain of an Uncharacterized family of the BRO1_Alix_like superfamily Back     alignment and domain information
>gnl|CDD|185763 cd09240, BRO1_Alix, Protein-interacting, N-terminal, Bro1-like domain of mammalian Alix and related domains Back     alignment and domain information
>gnl|CDD|185764 cd09241, BRO1_ScRim20-like, Protein-interacting, N-terminal, Bro1-like domain of Saccharomyces cerevisiae Rim20 and related proteins Back     alignment and domain information
>gnl|CDD|212023 cd11633, HR1_Rhophilin-1, Protein kinase C-related kinase homology region 1 (HR1) Rho-binding domain of Rhophilin-1 Back     alignment and domain information
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|212014 cd11624, HR1_Rhophilin, Protein kinase C-related kinase homology region 1 (HR1) Rho-binding domain of Rhophilin Back     alignment and domain information
>gnl|CDD|212024 cd11634, HR1_Rhophilin-2, Protein kinase C-related kinase homology region 1 (HR1) Rho-binding domain of Rhophilin-2 Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>gnl|CDD|185766 cd09243, BRO1_Brox_like, Protein-interacting Bro1-like domain of human Brox1 and related proteins Back     alignment and domain information
>gnl|CDD|216921 pfam02185, HR1, Hr1 repeat Back     alignment and domain information
>gnl|CDD|238489 cd00989, PDZ_metalloprotease, PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>gnl|CDD|221961 pfam13180, PDZ_2, PDZ domain Back     alignment and domain information
>gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>gnl|CDD|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 665
cd09249385 BRO1_Rhophilin_2 Protein-interacting Bro1-like dom 100.0
cd09248384 BRO1_Rhophilin_1 Protein-interacting Bro1-like dom 100.0
cd09244350 BRO1_Rhophilin Protein-interacting Bro1-like domai 100.0
cd09239361 BRO1_HD-PTP_like Protein-interacting, N-terminal, 100.0
cd09242348 BRO1_ScBro1_like Protein-interacting, N-terminal, 100.0
cd09241355 BRO1_ScRim20-like Protein-interacting, N-terminal, 100.0
cd09246353 BRO1_Alix_like_1 Protein-interacting, N-terminal, 100.0
cd09240346 BRO1_Alix Protein-interacting, N-terminal, Bro1-li 100.0
PF03097377 BRO1: BRO1-like domain; InterPro: IPR004328 The BR 100.0
cd09034345 BRO1_Alix_like Protein-interacting Bro1-like domai 100.0
cd09243353 BRO1_Brox_like Protein-interacting Bro1-like domai 100.0
KOG2220|consensus 714 100.0
cd09245413 BRO1_UmRIM23-like Protein-interacting, Bro1-like d 100.0
cd09247346 BRO1_Alix_like_2 Protein-interacting Bro1-like dom 100.0
KOG2220|consensus714 99.95
KOG3550|consensus207 99.45
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.33
KOG3551|consensus 506 99.14
KOG3549|consensus 505 99.12
KOG3209|consensus984 99.09
PRK11186 667 carboxy-terminal protease; Provisional 99.04
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 99.04
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 99.01
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.87
KOG3209|consensus984 98.79
COG0793 406 Prc Periplasmic protease [Cell envelope biogenesis 98.76
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.75
KOG3606|consensus358 98.74
KOG3552|consensus 1298 98.73
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 98.73
PLN00049 389 carboxyl-terminal processing protease; Provisional 98.63
KOG3553|consensus124 98.51
TIGR00225 334 prc C-terminal peptidase (prc). A C-terminal pepti 98.43
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.4
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.31
KOG3651|consensus 429 98.27
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.24
KOG3580|consensus 1027 98.17
KOG1892|consensus 1629 98.13
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 98.1
KOG3580|consensus 1027 98.08
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 98.01
KOG3542|consensus 1283 97.98
KOG0609|consensus 542 97.97
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 97.66
TIGR01713259 typeII_sec_gspC general secretion pathway protein 97.63
KOG0606|consensus 1205 97.63
KOG3571|consensus 626 97.57
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 97.55
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 97.52
PRK10139455 serine endoprotease; Provisional 97.5
PRK10139455 serine endoprotease; Provisional 97.5
PRK10779 449 zinc metallopeptidase RseP; Provisional 97.47
PRK10779 449 zinc metallopeptidase RseP; Provisional 97.46
PRK10942473 serine endoprotease; Provisional 97.45
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 97.41
PRK10942473 serine endoprotease; Provisional 97.4
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 97.39
PRK10898353 serine endoprotease; Provisional 97.38
KOG3605|consensus829 97.16
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 97.15
KOG3938|consensus334 97.14
KOG3605|consensus829 96.97
PF0218570 HR1: Hr1 repeat; InterPro: IPR000861 The HR1 repea 96.96
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 96.87
KOG3129|consensus231 96.85
TIGR02860 402 spore_IV_B stage IV sporulation protein B. SpoIVB, 96.81
cd0008972 HR1 Protein kinase C-related kinase homology regio 96.79
KOG1738|consensus 638 96.36
smart0074257 Hr1 Rho effector or protein kinase C-related kinas 96.35
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 96.27
COG3975558 Predicted protease with the C-terminal PDZ domain 96.11
COG0265347 DegQ Trypsin-like serine proteases, typically peri 95.91
KOG1320|consensus473 95.87
PRK09681276 putative type II secretion protein GspC; Provision 95.53
KOG3532|consensus 1051 95.48
KOG4407|consensus 1973 94.72
COG3480342 SdrC Predicted secreted protein containing a PDZ d 92.36
PF1281278 PDZ_1: PDZ-like domain 92.0
COG3031275 PulC Type II secretory pathway, component PulC [In 91.49
KOG1421|consensus 955 90.2
KOG3834|consensus 462 87.91
KOG3834|consensus 462 82.89
>cd09249 BRO1_Rhophilin_2 Protein-interacting Bro1-like domain of RhoA-binding protein Rhophilin-2 Back     alignment and domain information 
Probab=100.00  E-value=2.3e-92  Score=748.81  Aligned_cols=382  Identities=46%  Similarity=0.800  Sum_probs=361.2

Q ss_pred             cccCCCCCCCCCCChHHHHHHHhhhcCCChhhHHHHHHHHHHHHHHhcCCCCCchhhhHHHHHHHHHHHHHhccCCCCCC
Q psy12108        117 MIPLGLKETKEIDVREPFKDFILEHYSEDGTAYEDSVSEFMDMRQAMRTPNRDNSGISLLFQYYNQLYFIERRFFPPDRS  196 (665)
Q Consensus       117 mi~l~lK~T~~vD~~~~L~~~I~~~y~e~~~~~~~~i~~l~~LR~~~~~~~~~~~~~~~L~~Yy~qL~~l~~rf~~~~~~  196 (665)
                      |||||||+|++|||..||++||.++|+++++.|++||++|++||++++++.++++|+++|++||+||++|+.|||+++.+
T Consensus         1 ~i~lplK~T~~VD~~~pL~~yI~~~Y~q~~~~y~~dl~~l~~LR~~~~~~~~~~sg~e~L~~YY~qL~~Le~RFp~~~~~   80 (385)
T cd09249           1 LIPLGLKETKDVDFSVPLKDFILEHYSEDGSEYEDEIADLMDLRQACRTPSRDEAGVELLMSYFSQLGFLENRFFPPTRQ   80 (385)
T ss_pred             CCCCCCCcCCccChHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHhcCCCCChhHHHHHHHHHHHHHHHHhhCCCCccc
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999888888


Q ss_pred             cceeEe-ecCCCCCcccccchhHHHHHHHHHHHHHHHHHHhhcCCCChhhHHHHHHHHHHHHHhHHHHHhhccCCCCCCC
Q psy12108        197 LGIYFE-YDSLTGVPSCQRTIAFEKACVLFNMAAIYTQMAAKQDRLTSTGLDQAVDNFLRAAGTFTYLQENFTNAPSMDL  275 (665)
Q Consensus       197 ~~v~F~-~dslt~~~~~q~sl~fEkasVLfNiaal~sqia~~~~r~t~~glK~A~~~Fq~AAG~f~~l~e~~~~~ps~Dl  275 (665)
                      ++|.|+ ||+|+|.+++++++.||||||||||||+|||+|+.++|.+++|+|.||++||+|||+|+||++++.+.|+.||
T Consensus        81 ~~v~FtW~Dsf~~~~~~q~sl~fEkasVLFNigAl~Sqlaa~~~r~t~eGlK~A~~~FQ~AAG~F~~L~e~~~~~ps~Dl  160 (385)
T cd09249          81 MGILFTWYDSFTGVPVSQQNLLLEKASILFNIGALYTQIGTRCNRQTQAGLESAVDAFQRAAGVLNYLKETFTHTPSYDM  160 (385)
T ss_pred             ccceeeeeccCCCCccccccHHHHHHHHHHhHHHHHHHHHHHhccCCchhHHHHHHHHHHHHHHHHHHHHhccCCCCCcC
Confidence            999999 9999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ChhHHHHHHHHHHHHHHHHHHHHhhhccccccchhhHHHHHHHHHHHHHHHHHHHHhhcCccccCccchhHHHHHHHHHH
Q psy12108        276 GPPMLDMLIQLMLAQARECLFQKLQLQTTEKCDFQHMLELAQEAAQVAEVYMSLLSLITVPEVKDYVPLSWVSLIQVKKE  355 (665)
Q Consensus       276 s~~~L~~L~~lmLAQAQEc~~~Ka~~~~~~~~~~~l~~~iAklA~qv~~~Y~~a~~~~~~~~~~~~~~~~W~~~~~~K~~  355 (665)
                      ++++|++|+.|||||||||+|+|++.++. +....++++|||+|+||+++|++|++.|++.++++++|++|+.++++|++
T Consensus       161 s~~~L~~L~~LmLAQAQEc~~~Kai~d~~-k~~~~~i~kiAklAaqvs~~Y~~a~~al~s~~~~~~i~~~W~~~v~~K~~  239 (385)
T cd09249         161 SPAMLSVLVKMMLAQAQECLFEKISLPGI-RNEFFTLVKMAQEAAKVGEVYMQVHTAMNQAPVKENIPYSWSSLVQVKAH  239 (385)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHhccC-cchhhHHHHHHHHHHHHHHHHHHHHHHHhcccccccCCHHHHHHHHHHHH
Confidence            99999999999999999999999998764 22333467899999999999999999999888999999999999999999


Q ss_pred             HHHHHhhHHHhhhcccccccc--cchhhhhhhhhccccccccccccccCCCCcHHHHhHHHHHHHHHHHHHHHHHHHHHh
Q psy12108        356 HYLALSHYYCASGLLTKSLAN--LSSTAQTVLSYLHIPQENKKNLILEFEPEDESQRKQLGVAHLRSALLFHEESQRIYR  433 (665)
Q Consensus       356 ~f~A~A~y~~a~~l~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~kahLr~A~~~~eeAlRl~~  433 (665)
                      ||.|+||||+|..++++....  .....++++.++|..||+|.+  +..++++..+|+.+|||||++|+.+||||+|+++
T Consensus       240 ~f~AlA~Y~~A~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~k~hl~~a~~~~eea~r~~~  317 (385)
T cd09249         240 HYNALAHYFVATLLIDHQLNPSDDEDKQEKALSQLYDHMPEGLT--PLTILKNKQQRRLLGKAHLRRAIMHHEEAIREAS  317 (385)
T ss_pred             HHHHHHHHHHHHHHHhhhcCcccchHHHHHHHHHHHHhccccCC--hhhhhcccHHHHHHHHHHHHHHHHhhHHHHHHHH
Confidence            999999999999999875322  233444788999999999866  5568999999999999999999999999999999


Q ss_pred             HhhhhcchhHHHHHHHHHHHhHHHHhhhhcchhhhhhhccCCCCCCCCccccCCCCCCCCCchhhhHH
Q psy12108        434 MCRELRNKQALFQVLVQAHTLTLEMYADVEEEDEFNTMYEAPNITPSTKFQLTLTPPDFAHLPVEDLF  501 (665)
Q Consensus       434 ~c~~lr~~~~L~~vl~~a~~~s~~~y~~~~~edd~~~~~~ap~I~p~t~~~~~~~~P~f~~~~v~d~f  501 (665)
                      ||+.||+++.|++||+.+|++++.+|++++.+|||.++..+|+|+|+|++++++++|+|++++|+|+|
T Consensus       318 ~c~~l~~~~~l~~vl~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~v~d~f  385 (385)
T cd09249         318 LCKKLRNIDVLQEVLSAAHNRSLLKYAQHQKEDDFLDLIDAPDIVSKTEKKVEMIIPQFSKVKVTDLF  385 (385)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccchhhccccCCcccccccCccccCCCccccccCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999987

This subfamily contains the Bro1-like domain of RhoA-binding protein, Rhophilin-2. It belongs to the BRO1_Alix_like superfamily which also includes the Bro1-like domain of mammalian Alix (apoptosis-linked gene-2 interacting protein X), His-Domain type N23 protein tyrosine phosphatase (HD-PTP, also known as PTPN23), RhoA-binding protein Rhophilin-1, Brox, Bro1 and Rim20 (also known as PalA) from Saccharomyces cerevisiae, Ustilago maydis Rim23 (also known as PalC), and related domains. Rhophilin-2, binds both GDP- and GTP-bound RhoA. Bro1-like domains are boomerang-shaped, and part of the domain is a tetratricopeptide repeat (TPR)-like structure. In addition to this Bro1-like domain, Rhophilin-2 contains an N-terminal Rho-binding domain and a C-terminal PDZ (PS.D.-95, Disc-large, ZO-1) domain. Roles for Rhophilin-2 may include limiting stress fiber formation or increasing the turnover of F-
>cd09248 BRO1_Rhophilin_1 Protein-interacting Bro1-like domain of RhoA-binding protein Rhophilin-1 Back     alignment and domain information
>cd09244 BRO1_Rhophilin Protein-interacting Bro1-like domain of RhoA-binding protein Rhophilin and related domains Back     alignment and domain information
>cd09239 BRO1_HD-PTP_like Protein-interacting, N-terminal, Bro1-like domain of mammalian His-Domain type N23 protein tyrosine phosphatase and related domains Back     alignment and domain information
>cd09242 BRO1_ScBro1_like Protein-interacting, N-terminal, Bro1-like domain of Saccharomyces cerevisiae Bro1 and related proteins Back     alignment and domain information
>cd09241 BRO1_ScRim20-like Protein-interacting, N-terminal, Bro1-like domain of Saccharomyces cerevisiae Rim20 and related proteins Back     alignment and domain information
>cd09246 BRO1_Alix_like_1 Protein-interacting, N-terminal, Bro1-like domain of an Uncharacterized family of the BRO1_Alix_like superfamily Back     alignment and domain information
>cd09240 BRO1_Alix Protein-interacting, N-terminal, Bro1-like domain of mammalian Alix and related domains Back     alignment and domain information
>PF03097 BRO1: BRO1-like domain; InterPro: IPR004328 The BRO1 domain has about 390 residues and occurs in a number of eukaryotic proteins such as yeast BRO1 and human PDCD6IP/Alix that are involved in protein targeting to the vacuole or lysosome Back     alignment and domain information
>cd09034 BRO1_Alix_like Protein-interacting Bro1-like domain of mammalian Alix and related domains Back     alignment and domain information
>cd09243 BRO1_Brox_like Protein-interacting Bro1-like domain of human Brox1 and related proteins Back     alignment and domain information
>KOG2220|consensus Back     alignment and domain information
>cd09245 BRO1_UmRIM23-like Protein-interacting, Bro1-like domain of Ustilago maydis Rim23 (PalC), and related domains Back     alignment and domain information
>cd09247 BRO1_Alix_like_2 Protein-interacting Bro1-like domain of an Uncharacterized family of the BRO1_Alix_like superfamily Back     alignment and domain information
>KOG2220|consensus Back     alignment and domain information
>KOG3550|consensus Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>PF02185 HR1: Hr1 repeat; InterPro: IPR000861 The HR1 repeat was first described as a three times repeated homology region of the N-terminal non-catalytic part of protein kinase PRK1(PKN) [] Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>cd00089 HR1 Protein kinase C-related kinase homology region 1 domain; also known as the ACC (antiparallel coiled-coil) finger domain or Rho-binding domain Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>smart00742 Hr1 Rho effector or protein kinase C-related kinase homology region 1 homologues Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query665
3rau_A363 Crystal Structure Of The Hd-Ptp Bro1 Domain Length 6e-26
2oev_A 705 Crystal Structure Of AlixAIP1 Length = 705 5e-18
2xs1_A 704 Crystal Structure Of Alix In Complex With The Sivma 5e-18
2r02_A 697 Crystal Structure Of AlixAIP1 IN COMPLEX WITH THE H 6e-18
2oew_A380 Structure Of AlixAIP1 BRO1 DOMAIN Length = 380 8e-18
1zb1_A392 Structure Basis For Endosomal Targeting By The Bro1 2e-12
2kv8_A83 Solution Structure Ofrgs12 Pdz Domain Length = 83 1e-08
1vae_A111 Solution Structure Of The Pdz Domain Of Mouse Rhoph 9e-08
2vsv_A109 Crystal Structure Of The Pdz Domain Of Human Rhophi 1e-06
2dls_A93 Solution Structure Of The Pdz Domain Of Human Rho G 2e-06
2v90_A96 Crystal Structure Of The 3rd Pdz Domain Of Intestin 4e-06
2omj_A89 Solution Structure Of Larg Pdz Domain Length = 89 5e-06
3r69_A89 Molecular Analysis Of The Interaction Of The Hdl-Re 1e-04
1q3o_A109 Crystal Structure Of The Shank Pdz-ligand Complex R 1e-04
1uez_A101 Solution Structure Of The First Pdz Domain Of Human 1e-04
3r68_A95 Molecular Analysis Of The Pdz3 Domain Of Pdzk1 Leng 1e-04
3qjm_A115 Structural Flexibility Of Shank Pdz Domain Is Impor 2e-04
3l4f_D132 Crystal Structure Of Betapix Coiled-Coil Domain And 2e-04
2f5y_A91 Crystal Structure Of The Pdz Domain From Human Rgs- 6e-04
2eej_A96 Solution Structure Of Fourth Pdz Domain Of Pdz Doma 8e-04
>pdb|3RAU|A Chain A, Crystal Structure Of The Hd-Ptp Bro1 Domain Length = 363 Back     alignment and structure 
Iteration: 1

 Score =  115 bits (289), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 110/196 (56%), Gaps = 4/196 (2%)
Query: 109 FSKEPVMPMIPLGLKETKEIDVREPFKDFILEHYSEDGTAYEDSVSEFMDMRQ-AMRTPN 167
           F   P MPMI L LKE  +   +   K F+L++Y E+  AY + + +   +RQ A+R P 
Sbjct: 3   FEAVPRMPMIWLDLKEAGDFHFQPAVKKFVLKNYGENPEAYNEELKKLELLRQNAVRVP- 61
Query: 168 RDNSGISLLFQYYNQLYFIERRF-FPPDRSLGIYFEYDSL-TGVPSCQRTIAFEKACVLF 225
           RD  G S+L +Y  QL++++ R      +   +   +  + +G       I +E+AC+L+
Sbjct: 62  RDFEGCSVLRKYLGQLHYLQSRVPMGSGQEAAVPVTWTEIFSGKSVAHEDIKYEQACILY 121
Query: 226 NMAAIYTQMAAKQDRLTSTGLDQAVDNFLRAAGTFTYLQENFTNAPSMDLGPPMLDMLIQ 285
           N+ A+++ + A   R++  G+  +  +F  AAG F YL+E+F  A S+D+   +L + + 
Sbjct: 122 NLGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPQAYSVDMSRQILTLNVN 181
Query: 286 LMLAQARECLFQKLQL 301
           LML QA+ECL +K  L
Sbjct: 182 LMLGQAQECLLEKSML 197
>pdb|2OEV|A Chain A, Crystal Structure Of AlixAIP1 Length = 705 Back     alignment and structure
>pdb|2XS1|A Chain A, Crystal Structure Of Alix In Complex With The Sivmac239 Pykevtedl Late Domain Length = 704 Back     alignment and structure
>pdb|2R02|A Chain A, Crystal Structure Of AlixAIP1 IN COMPLEX WITH THE HIV-1 Ypltsl Late Domain Length = 697 Back     alignment and structure
>pdb|2OEW|A Chain A, Structure Of AlixAIP1 BRO1 DOMAIN Length = 380 Back     alignment and structure
>pdb|1ZB1|A Chain A, Structure Basis For Endosomal Targeting By The Bro1 Domain Length = 392 Back     alignment and structure
>pdb|2KV8|A Chain A, Solution Structure Ofrgs12 Pdz Domain Length = 83 Back     alignment and structure
>pdb|1VAE|A Chain A, Solution Structure Of The Pdz Domain Of Mouse Rhophilin-2 Length = 111 Back     alignment and structure
>pdb|2VSV|A Chain A, Crystal Structure Of The Pdz Domain Of Human Rhophilin-2 Length = 109 Back     alignment and structure
>pdb|2DLS|A Chain A, Solution Structure Of The Pdz Domain Of Human Rho Guanine Nucleotide Exchange Factor 11 Length = 93 Back     alignment and structure
>pdb|2V90|A Chain A, Crystal Structure Of The 3rd Pdz Domain Of Intestine- And Kidney-enriched Pdz Domain Ikepp (pdzd3) Length = 96 Back     alignment and structure
>pdb|2OMJ|A Chain A, Solution Structure Of Larg Pdz Domain Length = 89 Back     alignment and structure
>pdb|3R69|A Chain A, Molecular Analysis Of The Interaction Of The Hdl-Receptor Sr-Bi With The Pdz3 Domain Of Its Adaptor Protein Pdzk1 Length = 89 Back     alignment and structure
>pdb|1Q3O|A Chain A, Crystal Structure Of The Shank Pdz-ligand Complex Reveals A Class I Pdz Interaction And A Novel Pdz-pdz Dimerization Length = 109 Back     alignment and structure
>pdb|1UEZ|A Chain A, Solution Structure Of The First Pdz Domain Of Human Kiaa1526 Protein Length = 101 Back     alignment and structure
>pdb|3R68|A Chain A, Molecular Analysis Of The Pdz3 Domain Of Pdzk1 Length = 95 Back     alignment and structure
>pdb|3QJM|A Chain A, Structural Flexibility Of Shank Pdz Domain Is Important For Its Binding To Different Ligands Length = 115 Back     alignment and structure
>pdb|3L4F|D Chain D, Crystal Structure Of Betapix Coiled-Coil Domain And Shank Pdz Complex Length = 132 Back     alignment and structure
>pdb|2F5Y|A Chain A, Crystal Structure Of The Pdz Domain From Human Rgs-3 Length = 91 Back     alignment and structure
>pdb|2EEJ|A Chain A, Solution Structure Of Fourth Pdz Domain Of Pdz Domain Containing Protein 1 Length = 96 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query665
1zb1_A392 BRO1 protein; AIP1, BRO1 domain, SNF7, trafficking 2e-72
3rau_A363 Tyrosine-protein phosphatase non-receptor type 23; 6e-68
3c3r_A380 Programmed cell death 6-interacting protein; ALIX 4e-57
2xs1_A 704 Programmed cell death 6-interacting protein; prote 5e-55
3r9m_A376 BRO1 domain-containing protein BROX; protein bindi 3e-46
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 8e-34
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 9e-29
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 1e-28
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 4e-28
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 9e-27
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 2e-25
2d90_A102 PDZ domain containing protein 1; structural genomi 4e-25
2v90_A96 PDZ domain-containing protein 3; membrane, protein 9e-25
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 2e-24
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 3e-24
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 4e-24
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 9e-24
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 3e-23
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 4e-23
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 1e-22
2eei_A106 PDZ domain-containing protein 1; regulatory factor 1e-22
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 5e-22
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 1e-21
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 2e-21
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 4e-21
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 4e-21
2ego_A96 General receptor for phosphoinositides 1- associat 5e-21
3khf_A99 Microtubule-associated serine/threonine-protein ki 2e-20
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 9e-20
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 9e-20
2eaq_A90 LIM domain only protein 7; conserved hypothetical 4e-19
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 2e-18
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 4e-18
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 7e-18
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 8e-18
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 1e-17
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 1e-17
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 3e-17
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 5e-17
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 5e-17
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 6e-17
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 9e-17
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 1e-15
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 1e-15
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 3e-15
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 4e-15
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 5e-15
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 5e-15
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 8e-15
2eeh_A100 PDZ domain-containing protein 7; structural genomi 9e-15
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 2e-14
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 2e-14
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 2e-14
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 2e-14
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 2e-13
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 2e-14
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 3e-14
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 2e-06
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 5e-14
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 6e-14
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 6e-14
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 7e-14
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 9e-14
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 1e-13
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 1e-13
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 1e-13
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 2e-13
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 3e-13
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 3e-13
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 3e-13
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 3e-13
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 4e-13
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 4e-13
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 5e-13
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 8e-13
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 6e-13
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 6e-13
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 8e-13
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 2e-05
3k1r_A192 Harmonin; protein-protein complex, alternative spl 8e-13
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 1e-12
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 1e-12
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 1e-12
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 2e-12
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 2e-12
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 2e-12
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 2e-12
2djt_A104 Unnamed protein product; PDZ domain, structural ge 2e-12
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 2e-12
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 3e-12
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 3e-12
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 4e-12
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 4e-12
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 4e-12
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 5e-12
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 6e-12
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 6e-12
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 6e-12
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 7e-12
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 9e-12
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 2e-10
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 9e-12
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 1e-11
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 1e-11
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 1e-11
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 2e-11
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 2e-11
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 2e-11
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 4e-11
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 4e-11
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 4e-11
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 4e-11
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 5e-11
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 5e-11
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 5e-11
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 6e-11
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 6e-11
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 6e-11
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 8e-11
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 9e-11
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 1e-10
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 1e-10
2awx_A105 Synapse associated protein 97; membrane protein, s 1e-10
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 1e-10
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 2e-10
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 2e-10
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 2e-10
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 2e-10
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 2e-10
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 2e-10
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 3e-10
2opg_A98 Multiple PDZ domain protein; structural protein, s 3e-10
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 3e-10
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 3e-10
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 3e-10
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 4e-10
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 5e-10
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 5e-10
2fne_A117 Multiple PDZ domain protein; structural protein, s 7e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 9e-10
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 1e-09
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 1e-09
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 1e-09
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 2e-09
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 2e-09
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 2e-09
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 3e-09
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 4e-09
2byg_A117 Channel associated protein of synapse-110; DLG2, P 4e-09
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 5e-09
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-08
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 7e-09
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 8e-09
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 1e-08
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 2e-08
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 2e-08
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 4e-07
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 2e-08
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 3e-08
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 3e-08
2o2t_A117 Multiple PDZ domain protein; structural protein, s 5e-08
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 5e-08
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 7e-08
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 2e-07
1cxz_B86 Protein (PKN); protein-protein complex, antiparall 2e-07
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 2e-07
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 1e-06
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 2e-06
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 3e-06
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 1e-05
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 3e-05
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 1e-04
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 2e-04
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 2e-04
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 2e-04
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 2e-04
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 4e-04
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 5e-04
>1zb1_A BRO1 protein; AIP1, BRO1 domain, SNF7, trafficking, protein transport; 1.95A {Saccharomyces cerevisiae} Length = 392 Back     alignment and structure
 Score =  238 bits (608), Expect = 2e-72
 Identities = 76/413 (18%), Positives = 146/413 (35%), Gaps = 58/413 (14%)

Query: 116 PMIPLGLKETKEIDVREPFKDFILEHYSEDGTAY---EDSVSEFMDMRQAMRTPNRDNSG 172
            +  L LK+T+++D ++    ++ + Y          E + SE   +R         +S 
Sbjct: 9   YLFDLKLKDTEKLDWKKGLSSYLKKSYGSSQWRTFYDEKATSELDHLRNNANGELAPSSL 68

Query: 173 ISLLFQYYNQLYFIERRFFPPDRSLGIYFEY------DSLTGVPSCQRTIAFEKACVLFN 226
                +YY+ L  +  R       L + F +       +  G+   Q T+AFEK+C LFN
Sbjct: 69  SEQNLKYYSFLEHLYFRLGSKGSRLKMDFTWYDAEYSSAQKGLKYTQHTLAFEKSCTLFN 128

Query: 227 MAAIYTQMAAKQDRLTSTGLDQAVDNFLRAAGTFTYLQENFTNAPSMDLGPPMLDMLIQL 286
           +A I+TQ+A +           ++ N  +A   F YL ENF N+PS+DL       L  +
Sbjct: 129 IAVIFTQIARENIN---EDYKNSIANLTKAFSCFEYLSENFLNSPSVDLQSENTRFLANI 185

Query: 287 MLAQARECLFQKLQLQTTEKCDFQHMLELAQEAAQVAEVYMSLLSLI--TVPEVKDYVPL 344
             A+A+E    KL     +    Q+ L +++ +     ++      +     +V  Y   
Sbjct: 186 CHAEAQELFVLKLLND--QISSKQYTL-ISKLSRATCNLFQKCHDFMKEIDDDVAIYGEP 242

Query: 345 SWVSLIQVKKEHYLALSHYYCASGLLTKSLANLSSTAQTVLSYLHIPQENKKNLILEFEP 404
            W + +  K   Y +LS YY    L                                   
Sbjct: 243 KWKTTVTCKLHFYKSLSAYYHGLHL----------------------------------- 267

Query: 405 EDESQRKQLGVAHLRSALLFHEESQRIYRMCRELRNKQALFQVLVQAHTLTLEM-----Y 459
            +E  R    +A L  ++     S        E  +     + L +     ++      +
Sbjct: 268 -EEENRVGEAIAFLDFSMQQLISSLPFKTWLVEFIDFDGFKETLEKKQKELIKDNDFIYH 326

Query: 460 ADVEEEDEFNTMYEAPNITPSTKFQLTLTPPDFAHLPVEDLFKQLGPVAIFSA 512
             V    + +++     I   T  ++            + L++ + P+ ++  
Sbjct: 327 ESVPAVVQVDSIKALDAIKSPTWEKILEPYMQDVANKYDSLYRGIIPLDVYEK 379
>3rau_A Tyrosine-protein phosphatase non-receptor type 23; BRO1 domain, hydrolase; 1.95A {Homo sapiens} Length = 363 Back     alignment and structure
>3c3r_A Programmed cell death 6-interacting protein; ALIX BRO1 CHMP4C amphipathic-helix, apoptosis, HOST-virus interaction, protein transport, transport; 2.02A {Homo sapiens} PDB: 2oew_A 3c3o_A 3c3q_A Length = 380 Back     alignment and structure
>2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 Back     alignment and structure
>3r9m_A BRO1 domain-containing protein BROX; protein binding; 1.95A {Homo sapiens} PDB: 3um3_A 3zxp_A 3um2_A 3um1_A 3uly_A 3um0_A Length = 376 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>1cxz_B Protein (PKN); protein-protein complex, antiparallel coiled-coil, signaling protein; HET: GSP; 2.20A {Homo sapiens} SCOP: a.2.6.1 Length = 86 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Length = 113 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Length = 112 Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Length = 95 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query665
3rau_A363 Tyrosine-protein phosphatase non-receptor type 23; 100.0
1zb1_A392 BRO1 protein; AIP1, BRO1 domain, SNF7, trafficking 100.0
3c3r_A380 Programmed cell death 6-interacting protein; ALIX 100.0
2xs1_A 704 Programmed cell death 6-interacting protein; prote 100.0
3r9m_A376 BRO1 domain-containing protein BROX; protein bindi 100.0
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.65
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 99.55
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 99.5
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.5
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.5
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.47
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.47
2ego_A96 General receptor for phosphoinositides 1- associat 99.47
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.47
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 99.46
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.46
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.46
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 99.46
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.46
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.45
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 99.45
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 99.45
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.44
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.44
2eei_A106 PDZ domain-containing protein 1; regulatory factor 99.43
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 99.43
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.43
1cxz_B86 Protein (PKN); protein-protein complex, antiparall 99.42
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 99.42
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 99.42
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.41
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 99.41
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 99.41
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.41
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.4
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.4
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 99.4
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.4
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 99.39
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 99.39
2d90_A102 PDZ domain containing protein 1; structural genomi 99.39
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.39
2awx_A105 Synapse associated protein 97; membrane protein, s 99.39
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.39
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.38
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 99.38
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.38
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.38
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.37
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.37
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 99.37
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 99.37
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.37
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 99.37
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 99.36
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 99.36
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.36
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.36
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 99.36
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 99.36
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.35
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.35
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.35
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.35
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.35
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.35
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 99.35
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 99.34
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 99.34
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 99.34
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.34
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 99.34
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 99.34
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.34
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.33
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.33
2o2t_A117 Multiple PDZ domain protein; structural protein, s 99.33
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.33
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.33
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.33
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 99.33
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 99.33
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 99.33
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 99.32
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.32
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.32
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 99.32
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 99.32
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 99.32
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 99.31
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 98.99
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 99.31
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 99.31
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 99.31
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.31
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.3
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.3
3khf_A99 Microtubule-associated serine/threonine-protein ki 99.3
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.3
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.3
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 99.29
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 99.29
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.29
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 99.29
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 99.29
2eeh_A100 PDZ domain-containing protein 7; structural genomi 99.29
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 99.29
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 99.28
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 99.28
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 99.28
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.28
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 99.28
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 99.28
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 99.27
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.27
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 99.26
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.26
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 99.26
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 99.26
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 99.26
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 99.25
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.25
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 99.25
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 99.25
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 99.25
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 99.24
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 99.24
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 99.24
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 99.23
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 99.22
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 99.22
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 99.22
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.22
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.21
3k1r_A192 Harmonin; protein-protein complex, alternative spl 99.21
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 99.2
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 99.19
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 99.19
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 99.18
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 99.18
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 99.17
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 99.17
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 99.17
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 99.17
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 99.15
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 99.15
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 99.14
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.13
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 99.11
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.11
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 99.1
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 99.1
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 99.09
2eaq_A90 LIM domain only protein 7; conserved hypothetical 99.09
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 99.09
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 99.08
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 99.07
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 99.06
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.03
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.03
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.03
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 99.01
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.0
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.0
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 98.99
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 98.98
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 98.97
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.91
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 98.9
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.89
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 98.73
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 98.73
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 98.7
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 98.69
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 98.67
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 98.44
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 98.42
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.4
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.36
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 98.35
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.34
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 98.31
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 98.29
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 98.29
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.28
2kl1_A94 YLBL protein; structure genomics, structural genom 98.27
3k50_A 403 Putative S41 protease; structural genomics, joint 98.18
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.12
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 98.11
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 98.02
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 98.01
2hga_A125 Conserved protein MTH1368; GFT structural genomics 97.98
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 97.93
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 97.91
4fgm_A597 Aminopeptidase N family protein; structural genomi 97.9
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 97.81
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 97.78
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 97.78
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 97.73
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 97.69
1k32_A 1045 Tricorn protease; protein degradation, substrate g 97.68
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 97.67
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 97.5
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 97.28
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 97.27
4fln_A 539 Protease DO-like 2, chloroplastic; protease, DEG, 96.69
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 95.42
2ke4_A98 CDC42-interacting protein 4; CIP4, TC10, coiled-co 84.05
>3rau_A Tyrosine-protein phosphatase non-receptor type 23; BRO1 domain, hydrolase; 1.95A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=7e-69  Score=578.96  Aligned_cols=320  Identities=26%  Similarity=0.426  Sum_probs=293.3

Q ss_pred             CCCccccccCCCCCCCCCCChHHHHHHHhhhcCCChhhHHHHHHHHHHHHHHhcCCCCCchhhhHHHHHHHHHHHHHhcc
Q psy12108        111 KEPVMPMIPLGLKETKEIDVREPFKDFILEHYSEDGTAYEDSVSEFMDMRQAMRTPNRDNSGISLLFQYYNQLYFIERRF  190 (665)
Q Consensus       111 ~~~~~pmi~l~lK~T~~vD~~~~L~~~I~~~y~e~~~~~~~~i~~l~~LR~~~~~~~~~~~~~~~L~~Yy~qL~~l~~rf  190 (665)
                      -.|+||||+||||+|++|||..||++||.+||+|+++.|+++|++|++||++++++.+|++|+++|++||+||++|+.||
T Consensus         5 ~~~~~pmi~l~lK~t~~vd~~~~L~~~I~~~y~e~~~~~~~~l~~l~~LR~~~~~~~~~~~g~~~L~~Yy~qL~~l~~rf   84 (363)
T 3rau_A            5 AVPRMPMIWLDLKEAGDFHFQPAVKKFVLKNYGENPEAYNEELKKLELLRQNAVRVPRDFEGCSVLRKYLGQLHYLQSRV   84 (363)
T ss_dssp             -CCCCCCCCCCCCCEEEECCHHHHHHHHHHTTCSCTTTTHHHHHHHHHHHHHHHTCCSSHHHHHHHHHHHHHHHHHHHHS
T ss_pred             cCCcCCccCCCCCcCCCCChHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHhccCCCCHHHHHHHHHHHHHHHHHHhcC
Confidence            46799999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CC-CCCCcceeEe-ecCCCCCcccccchhHHHHHHHHHHHHHHHHHHhhcCCCChhhHHHHHHHHHHHHHhHHHHHhhcc
Q psy12108        191 FP-PDRSLGIYFE-YDSLTGVPSCQRTIAFEKACVLFNMAAIYTQMAAKQDRLTSTGLDQAVDNFLRAAGTFTYLQENFT  268 (665)
Q Consensus       191 ~~-~~~~~~v~F~-~dslt~~~~~q~sl~fEkasVLfNiaal~sqia~~~~r~t~~glK~A~~~Fq~AAG~f~~l~e~~~  268 (665)
                      |. +++..+|.|+ ||+|+|+++++.++.||+|||||||||+|||+|++++|.+++|+|.||++||+|||+|+||++++.
T Consensus        85 p~~~~~~~~i~F~W~ds~~~~~~~~~sl~fE~a~VLfNiaal~s~~a~~~~r~~~~glK~A~~~fq~AAG~f~~l~~~~~  164 (363)
T 3rau_A           85 PMGSGQEAAVPVTWTEIFSGKSVAHEDIKYEQACILYNLGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFP  164 (363)
T ss_dssp             CCSTTCTTCCCEEEECTTTCCEEEESCHHHHHHHHHHHHHHHHHHHHHHSCCCSHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_pred             CCCcccccceeEEeecccCCccccccCHHHHHHHHHHHHHHHHHHHHHHhccCChHHHHHHHHHHHHHHHHHHHHHHhcC
Confidence            64 4456799999 999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCChhHHHHHHHHHHHHHHHHHHHHhhhccccccchhhHHHHHHHHHHHHHHHHHHHHhhcCccc---cCccchh
Q psy12108        269 NAPSMDLGPPMLDMLIQLMLAQARECLFQKLQLQTTEKCDFQHMLELAQEAAQVAEVYMSLLSLITVPEV---KDYVPLS  345 (665)
Q Consensus       269 ~~ps~Dls~~~L~~L~~lmLAQAQEc~~~Ka~~~~~~~~~~~l~~~iAklA~qv~~~Y~~a~~~~~~~~~---~~~~~~~  345 (665)
                      +.|+.||++++|.+|..+||||||||+|+|++.++.   +..+   |||+|+||+++|++|++.+++.+.   .+.++++
T Consensus       165 ~~~~~Dls~~~l~~L~~l~LAQAQE~~~~Kai~~~~---k~~l---iAkLa~q~~~~Y~~a~~~l~~~~~~~~~~~~~~~  238 (363)
T 3rau_A          165 QAYSVDMSRQILTLNVNLMLGQAQECLLEKSMLDNR---KSFL---VARISAQVVDYYKEACRALENPDTASLLGRIQKD  238 (363)
T ss_dssp             SCSSGGGSHHHHHHHHHHHHHHHHHHHHHHHHHTTC---CHHH---HHHHHHHHHHHHHHHHHHHTCHHHHHHHTTHHHH
T ss_pred             CCCCCcCCHHHHHHHHHHHHHHHHHHHHHHHHhcCC---chhH---HHHHHHHHHHHHHHHHHHHhcCccccccccccHH
Confidence            999999999999999999999999999999998653   4554   899999999999999999987653   4578999


Q ss_pred             HHHHHHHHHHHHHHHhhHHHhhhcccccccccchhhhhhhhhccccccccccccccCCCCcHHHHhHHHHHHHHHHHHHH
Q psy12108        346 WVSLIQVKKEHYLALSHYYCASGLLTKSLANLSSTAQTVLSYLHIPQENKKNLILEFEPEDESQRKQLGVAHLRSALLFH  425 (665)
Q Consensus       346 W~~~~~~K~~~f~A~A~y~~a~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~kahLr~A~~~~  425 (665)
                      |..++++|..||+|+||||+|+.+.+..                                    ++|+++|||+.|...+
T Consensus       239 w~~~v~~K~~~~~A~A~y~~a~~~~e~~------------------------------------k~GeaIa~L~~A~~~l  282 (363)
T 3rau_A          239 WKKLVQMKIYYFAAVAHLHMGKQAEEQQ------------------------------------KFGERVAYFQSALDKL  282 (363)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHTT------------------------------------CHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhHHHhh------------------------------------hHHHHHHHHHHHHHHH
Confidence            9999999999999999999999876643                                    7999999999999999


Q ss_pred             HHHHHHHhHhhhhcchhHHHHHHHHHHHhHHHHhhhhcchhhhhhhccCCCC
Q psy12108        426 EESQRIYRMCRELRNKQALFQVLVQAHTLTLEMYADVEEEDEFNTMYEAPNI  477 (665)
Q Consensus       426 eeAlRl~~~c~~lr~~~~L~~vl~~a~~~s~~~y~~~~~edd~~~~~~ap~I  477 (665)
                      ++|.+..+     .....+++.++...+....++.+.+++|||...-.+|+.
T Consensus       283 ~~a~~~~k-----~~~~~~~~~~~~~~~~i~~~l~~aekdNd~IY~~~VP~~  329 (363)
T 3rau_A          283 NEAIKLAK-----GQPDTVQDALRFTMDVIGGKYNSAKKDNDFIYHEAVPAL  329 (363)
T ss_dssp             HHHHHHTT-----TCCHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCCCCCG
T ss_pred             HHHHHHhc-----CCchhHHHHHHHHHHHHHHHHHHHHhccCcCCcccCCCc
Confidence            99999843     245677777877777888888889999999888777764
>1zb1_A BRO1 protein; AIP1, BRO1 domain, SNF7, trafficking, protein transport; 1.95A {Saccharomyces cerevisiae} Back     alignment and structure
>3c3r_A Programmed cell death 6-interacting protein; ALIX BRO1 CHMP4C amphipathic-helix, apoptosis, HOST-virus interaction, protein transport, transport; 2.02A {Homo sapiens} PDB: 2oew_A 3c3o_A 3c3q_A Back     alignment and structure
>2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Back     alignment and structure
>3r9m_A BRO1 domain-containing protein BROX; protein binding; 1.95A {Homo sapiens} PDB: 3um3_A 3zxp_A 3um2_A 3um1_A 3uly_A 3um0_A Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1cxz_B Protein (PKN); protein-protein complex, antiparallel coiled-coil, signaling protein; HET: GSP; 2.20A {Homo sapiens} SCOP: a.2.6.1 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>2ke4_A CDC42-interacting protein 4; CIP4, TC10, coiled-coil, alternative splicing, cell membrane, coiled coil, cytoplasm, cytoskeleton, endocytosis; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 665
d1vaea_111 b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T 5e-23
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 4e-19
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 2e-18
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 1e-16
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 2e-16
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 3e-16
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 1e-15
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 3e-15
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 3e-15
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 4e-15
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 6e-15
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 9e-15
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 1e-14
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 2e-14
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 2e-14
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 2e-14
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 2e-14
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 2e-14
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 2e-14
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 3e-14
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 3e-14
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 4e-14
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 6e-14
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 1e-13
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 2e-13
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 2e-13
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 3e-13
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 3e-13
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 4e-13
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 7e-13
d1r6ja_82 b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta 8e-13
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 1e-12
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 1e-12
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 1e-12
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 1e-12
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-12
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 1e-12
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 1e-12
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 1e-12
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-12
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 2e-12
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 4e-12
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 5e-12
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 6e-12
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 6e-12
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 6e-12
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 1e-11
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 1e-11
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 1e-11
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 1e-11
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 2e-11
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 2e-11
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 5e-11
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 7e-11
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 7e-11
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 8e-11
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-10
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 1e-10
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 1e-09
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 6e-09
d1cxzb_86 a.2.6.1 (B:) Protein kinase c-like 1, pkn/prk1 {Hu 6e-09
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 1e-08
d1fc6a392 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal 6e-07
d2z9ia188 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium 9e-07
d1ky9b288 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-t 1e-06
d1lcya1100 b.36.1.4 (A:226-325) Mitochondrial serine protease 7e-06
d2i6va187 b.36.1.5 (A:219-305) General secretion pathway pro 8e-04
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure

class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Rhophilin-2
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 92.4 bits (229), Expect = 5e-23
 Identities = 33/99 (33%), Positives = 54/99 (54%), Gaps = 4/99 (4%)

Query: 511 SAKHHWTAPRSIQLQRANNSDTGFGFSVRGDAPVIVASVDSGSLAQFGGMKDGDFIVAIG 570
           SA   W+ PR I        +   GF++RG+ PV V  +D    A   G K+GD+IV+I 
Sbjct: 8   SASKRWSPPRGIHFTV---EEGDLGFTLRGNTPVQVHFLDPHCSASLAGAKEGDYIVSIQ 64

Query: 571 DRDVKWSPHEEVVQLIKDA-GKCLSLKLVTPMHKNNNVH 608
             D KW    EV++L+K   G+ + +K+V+ +   +++H
Sbjct: 65  GVDCKWLTVSEVMKLLKSFGGEEVEMKVVSLLDSTSSMH 103
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d1cxzb_ a.2.6.1 (B:) Protein kinase c-like 1, pkn/prk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 92 Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 88 Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Length = 87 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query665
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.7
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.67
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.64
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.63
d1cxzb_86 Protein kinase c-like 1, pkn/prk1 {Human (Homo sap 99.62
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.6
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.58
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.58
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.57
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.56
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.55
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.55
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.55
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.54
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.54
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.54
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.53
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 99.53
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.53
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.52
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.51
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.5
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.5
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.5
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.49
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.49
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.48
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.48
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.48
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.48
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.48
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.47
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.47
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.46
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.46
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.45
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.45
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.45
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.45
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.43
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.43
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 99.42
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.42
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 99.42
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.4
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.4
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.38
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.38
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.38
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.38
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.37
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 99.36
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.35
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.34
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.31
d1fc6a392 Photosystem II D1 C-terminal processing protease { 99.3
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.3
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.29
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 99.25
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 99.22
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.11
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 98.9
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.76
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.67
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 98.58
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.46
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.34
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 98.32
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.25
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Rhophilin-2
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.70  E-value=7.6e-18  Score=149.02  Aligned_cols=95  Identities=34%  Similarity=0.652  Sum_probs=83.7

Q ss_pred             cccccccccceeEEeccCCCCCcceeEEEEcCCCeEEEEeCCCChhhhcCCCCCCEEEEECCEecCCCChHHHHHHHHhh
Q psy12108        510 FSAKHHWTAPRSIQLQRANNSDTGFGFSVRGDAPVIVASVDSGSLAQFGGMKDGDFIVAIGDRDVKWSPHEEVVQLIKDA  589 (665)
Q Consensus       510 f~~~~~~~~~r~v~l~rg~~~~~g~Gf~l~g~~~v~V~~V~pgspA~~aGLk~GD~Il~VnG~~v~~~~~~evv~~ik~~  589 (665)
                      ..+..+|..||+|+|.|+   .++|||+|+|+.|++|..|.|+|||+++||++||+|++|||++|.+++|++|+++|+++
T Consensus         7 ~~~~~~~~~pr~v~l~k~---~~g~Gf~i~g~~~v~V~~V~~~spA~~~GL~~GD~Il~INg~~v~~~~~~ev~~llk~~   83 (111)
T d1vaea_           7 GSASKRWSPPRGIHFTVE---EGDLGFTLRGNTPVQVHFLDPHCSASLAGAKEGDYIVSIQGVDCKWLTVSEVMKLLKSF   83 (111)
T ss_dssp             CCCCCEECCCCCCCEECC---SSCCSCCEESSSSCEECCCCTTSSHHHHHCCTTCEEEEETTEECSSCCHHHHHHHHHHT
T ss_pred             CCCccCCCCCEEEEEEEC---CCccCEEEECCccEEEEEEcCCChHHhcccCcccEEEEECCEEcCCCCHHHHHHHHHcC
Confidence            345668899999999995   45899999999999999999999999999999999999999999999999999999988


Q ss_pred             C-CceeEEEEcCCCCCCcc
Q psy12108        590 G-KCLSLKLVTPMHKNNNV  607 (665)
Q Consensus       590 g-~~v~L~V~~~~~~~~~~  607 (665)
                      + ..|+|+|+++.+.....
T Consensus        84 ~~~~v~l~v~~~~~~~~~~  102 (111)
T d1vaea_          84 GGEEVEMKVVSLLDSTSSM  102 (111)
T ss_dssp             TTSEECEEEECEECCCCCC
T ss_pred             CCCeEEEEEECCCCCCCCc
Confidence            5 58999998765444333
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cxzb_ a.2.6.1 (B:) Protein kinase c-like 1, pkn/prk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure