Diaphorina citri psyllid: psy12113


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------37
LFNNEQKGLLLAVGFLISAFWAGVHVCFYDAFVWNMILAVVNVSHAGALISIFLPPALSIELTELYIRVFNPVKISKKQFKELTSEATICKLAQGESYAIEERTSADERLSILLRGKLLLAVGFLISAFWAGVHVCFYDAFVWNMILAVVNVSHAGALISIFLPPALSIELTELYIRVFNPVKISKKQFKELTSEATICKLAQGESYAIEERTSADERLSILLRGKMTVTCNDTHLHYVCPFQFVDSPEYMSCQNSSDELYQVSITAEEDCLYLCWSRISLDRLLRHRPMLKSVFNSLIGKDITQKLYSLNELISTNAQNKDEPWRHKMNRSVSVDAVNTSSRGQVRSSNWRSTHSSMKKNLSNISQSK
cccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccccHHHHHHHHcccEEEEcccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccccHHHHHHHHHccEEEEcccccEEEEEcccccccEEEEEEEccEEEEEccCEEEEEcccccccccccccccccccccEEEEEEEEccEEEEEEEHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
**NNEQKGLLLAVGFLISAFWAGVHVCFYDAFVWNMILAVVNVSHAGALISIFLPPALSIELTELYIRVFNPVKISKKQFKELTSEATICKLAQGESYAIEERTSADERLSILLRGKLLLAVGFLISAFWAGVHVCFYDAFVWNMILAVVNVSHAGALISIFLPPALSIELTELYIRVFNPVKISKKQFKELTSEATICKLAQGESYAIEERTSADERLSILLRGKMTVTCNDTHLHYVCPFQFVDSPEYMSCQNSSDELYQVSITAEEDCLYLCWSRISLDRLLRHRPMLKSVFNSLIGKDITQKLYSLNELIS******************************************************
xxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LFNNEQKGLLLAVGFLISAFWAGVHVCFYDAFVWNMILAVVNVSHAGALISIFLPPALSIELTELYIRVFNPVKISKKQFKELTSEATICKLAQGESYAIEERTSADERLSILLRGKLLLAVGFLISAFWAGVHVCFYDAFVWNMILAVVNVSHAGALISIFLPPALSIELTELYIRVFNPVKISKKQFKELTSEATICKLAQGESYAIEERTSADERLSILLRGKMTVTCNDTHLHYVCPFQFVDSPEYMSCQNSSDELYQVSITAEEDCLYLCWSRISLDRLLRHRPMLKSVFNSLIGKDITQKLYSLNELISTNAQNKDEPWRHKMNRSVSVDAVNTSSRGQVRSSNWRSTHSSMKKNLSNISQSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Blood vessel epicardial substance Cell adhesion molecule involved in the establishment and/or maintenance of cell integrity. May play a role in vamp3-mediated vesicular transport and recycling of receptor molecules. May be involved in the formation and regulation of the tight junction (TJ) paracellular permeability barrier in epithelial cells. May induce primordial adhesive contact and aggregation of epithelial cells in a Ca(2+)-independent manner. May be involved in epithelial movement during corneal sheet formation and regeneration. May play a role in the regulation of cell shape and movement by modulating the Rho-GTPase activity. May also be involved in striated muscle regeneration and in the regulation of cell spreading.confidentQ5PQZ7
Blood vessel epicardial substance Cell adhesion molecule involved in the establishment and/or maintenance of cell integrity. Involved in the formation and regulation of the tight junction (TJ) paracellular permeability barrier in epithelial cells. Induces primordial adhesive contact and aggregation of epithelial cells in a Ca(2+)-independent manner. Involved in epithelial movement during corneal sheet formation and regeneration. May play a role in VAMP3-mediated vesicular transport and recycling of receptor molecules. May play a role in the regulation of cell shape and movement by modulating the Rho-GTPase activity. May also be involved in striated muscle regeneration and in the regulation of cell spreading.confidentQ9DG23

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0034446 [BP]substrate adhesion-dependent cell spreadingprobableGO:0032502, GO:0031589, GO:0000904, GO:0000902, GO:0009653, GO:0048869, GO:0030154, GO:0048468, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0071840, GO:0007155, GO:0008150, GO:0009987, GO:0022610, GO:0044699, GO:0048856
GO:0005198 [MF]structural molecule activityprobableGO:0003674
GO:0008360 [BP]regulation of cell shapeprobableGO:0022604, GO:0022603, GO:0050793, GO:0051128, GO:0065007, GO:0008150, GO:0065008, GO:0050789, GO:0050794
GO:0016192 [BP]vesicle-mediated transportprobableGO:0006810, GO:0008150, GO:0051179, GO:0051234
GO:0032314 [BP]regulation of Rac GTPase activityprobableGO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0035023, GO:0048583, GO:0035020, GO:0023051, GO:0010646, GO:0043087, GO:0050789, GO:0032319, GO:0032318, GO:0031329, GO:0009966, GO:0031323, GO:0030811, GO:0065007, GO:0065009, GO:0051056, GO:0033121, GO:0033124, GO:0019219, GO:0046578, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0009118, GO:0051336, GO:1900542, GO:0006140
GO:0043088 [BP]regulation of Cdc42 GTPase activityprobableGO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0035023, GO:0048583, GO:0023051, GO:0010646, GO:0043087, GO:0050789, GO:0032319, GO:0032318, GO:0031329, GO:0009966, GO:0031323, GO:0030811, GO:0065007, GO:0065009, GO:0051056, GO:0033121, GO:0033124, GO:0019219, GO:0046578, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0032489, GO:0009118, GO:0051336, GO:1900542, GO:0006140
GO:0016328 [CC]lateral plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0090136 [BP]epithelial cell-cell adhesionprobableGO:0016337, GO:0009987, GO:0044763, GO:0007155, GO:0008150, GO:0022610, GO:0044699
GO:0005923 [CC]tight junctionprobableGO:0005575, GO:0070160, GO:0043296, GO:0030054, GO:0005911
GO:0001921 [BP]positive regulation of receptor recyclingprobableGO:0010604, GO:0019222, GO:0060255, GO:0031325, GO:0031323, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0001919, GO:0048522, GO:0050789, GO:0009893
GO:0040017 [BP]positive regulation of locomotionprobableGO:0048518, GO:0008150, GO:0040012, GO:0065007, GO:0050789

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DN7, chain A
Confidence level:confident
Coverage over the Query: 176-318
View the alignment between query and template
View the model in PyMOL