Diaphorina citri psyllid: psy12115


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
MSKGDVFGDSFWKDNAVGQSAANVRALTYCDLHTIKRDRLLEVLDFYQAFANSFARNLLLTYNLRHRKRDSINLFVSSIISRIPLTYCDLHTIKRDRLLEVLDFYQAFANSFARNLLLTYNLRHRLVSNMTFITLTPKTRLKNSMYIILEERGR
ccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccEEEEEccccccccccccccccccccccccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHccc
MSKGDVFGDSFWKDNAVGQSAANVRALTYCDLHTIKRDRLLEVLDFYQAFANSFARNLLLTYNLRHRKRDSI*L*VSSIISRIPLTYCDLHTIKRDRLLEVLDFYQAFANSFARNLLLTYNLRHRLVSNMTFITLTPKTRLKNSMYIIL*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKGDVFGDSFWKDNAVGQSAANVRALTYCDLHTIKRDRLLEVLDFYQAFANSFARNLLLTYNLRHRKRDSINLFVSSIISRIPLTYCDLHTIKRDRLLEVLDFYQAFANSFARNLLLTYNLRHRLVSNMTFITLTPKTRLKNSMYIILEERGR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Potassium voltage-gated channel subfamily H member 1 Pore-forming (alpha) subunit of voltage-gated non-inactivating delayed rectifier potassium channel. Channel properties may be modulated by cAMP and subunit assembly. Mediates IK(NI) current in myoblasts.confidentO18965
Potassium voltage-gated channel subfamily H member 1 Pore-forming (alpha) subunit of voltage-gated non-inactivating delayed rectifier potassium channel. Channel properties may be modulated by cAMP and subunit assembly. Mediates IK(NI) current in myoblasts.confidentQ63472
Potassium voltage-gated channel protein eag Structural component of a potassium channel. Mediates the potassium permeability of membranes; potassium current is regulated by CaMKII and CASK. Has a role in growth of the perineurial glial layer of the larval peripheral nerve.confidentQ02280

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0051291 [BP]protein heterooligomerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0010389 [BP]regulation of G2/M transition of mitotic cell cycleprobableGO:0007346, GO:0051726, GO:0010564, GO:0050794, GO:1901987, GO:0065007, GO:1901990, GO:0008150, GO:0050789
GO:0007612 [BP]learningprobableGO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0050890, GO:0007610, GO:0007611, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0001756 [BP]somitogenesisprobableGO:0032502, GO:0007389, GO:0044699, GO:0032501, GO:0009952, GO:0044707, GO:0048856, GO:0007275, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0003002, GO:0043009, GO:0009653, GO:0035282, GO:0048646, GO:0061053
GO:0000160 [BP]phosphorelay signal transduction systemprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0006936 [BP]muscle contractionprobableGO:0032501, GO:0044707, GO:0003012, GO:0008150, GO:0044699, GO:0003008
GO:0008076 [CC]voltage-gated potassium channel complexprobableGO:0043234, GO:0032991, GO:0044459, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0034702, GO:0034705, GO:0071944, GO:0034703, GO:0005887, GO:0005886, GO:0044425, GO:0031226, GO:0031224
GO:0019901 [MF]protein kinase bindingprobableGO:0019900, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0030163 [BP]protein catabolic processprobableGO:0044238, GO:1901575, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152, GO:0009056, GO:0009057
GO:0007520 [BP]myoblast fusionprobableGO:0030154, GO:0061061, GO:0014706, GO:0000768, GO:0006949, GO:0009653, GO:0007275, GO:0044699, GO:0007517, GO:0051146, GO:0007519, GO:0048513, GO:0048869, GO:0035914, GO:0048646, GO:0032502, GO:0032501, GO:0014902, GO:0009987, GO:0009888, GO:0044767, GO:0044763, GO:0048731, GO:0044707, GO:0048856, GO:0060537, GO:0060538, GO:0008150, GO:0042692
GO:0018991 [BP]ovipositionprobableGO:0032501, GO:0048609, GO:0032504, GO:0019098, GO:0050896, GO:0044706, GO:0007610, GO:0022414, GO:0008150, GO:0033057, GO:0000003, GO:0051704
GO:0000155 [MF]phosphorelay sensor kinase activityprobableGO:0038023, GO:0004673, GO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0016775, GO:0060089, GO:0016740, GO:0003674, GO:0004872, GO:0004871, GO:0004672
GO:0007635 [BP]chemosensory behaviorprobableGO:0042221, GO:0050896, GO:0008150, GO:0007610, GO:0044708
GO:0060307 [BP]regulation of ventricular cardiac muscle cell membrane repolarizationprobableGO:0042391, GO:0051049, GO:0050801, GO:0055082, GO:0060306, GO:0032844, GO:0042592, GO:0001508, GO:0034765, GO:0050789, GO:0034762, GO:0051234, GO:0086001, GO:0086009, GO:0051179, GO:0065007, GO:0043269, GO:0065008, GO:0019725, GO:0006810, GO:0006811, GO:0009987, GO:0006873, GO:0050794, GO:0034220, GO:0044765, GO:0008150, GO:0086013, GO:0086011, GO:0032879, GO:0055085, GO:0044699, GO:0086036, GO:0048878, GO:2000021, GO:0044763
GO:0008016 [BP]regulation of heart contractionprobableGO:0008150, GO:0065007, GO:0051239, GO:0044057, GO:0050789
GO:0007629 [BP]flight behaviorprobableGO:0007626, GO:0032501, GO:0044707, GO:0030534, GO:0044708, GO:0050896, GO:0007610, GO:0008150, GO:0008344, GO:0044699
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0042066 [BP]perineurial glial growthprobableGO:0048589, GO:0048588, GO:0030154, GO:0048468, GO:0007275, GO:0044699, GO:0016049, GO:0040007, GO:0048869, GO:0032502, GO:0032501, GO:0042065, GO:0042063, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0007399, GO:0044707, GO:0048856, GO:0008150, GO:0009987
GO:0005242 [MF]inward rectifier potassium channel activityprobableGO:0005267, GO:0005261, GO:0003674, GO:0015276, GO:0022857, GO:0022843, GO:0022803, GO:0046873, GO:0005215, GO:0005216, GO:0008324, GO:0022891, GO:0022890, GO:0022892, GO:0005244, GO:0015075, GO:0022832, GO:0015077, GO:0015267, GO:0022836, GO:0005249, GO:0022834, GO:0022839, GO:0022838, GO:0015079
GO:0005251 [MF]delayed rectifier potassium channel activityprobableGO:0005267, GO:0005261, GO:0003674, GO:0015077, GO:0022843, GO:0022803, GO:0046873, GO:0005215, GO:0005216, GO:0008324, GO:0022891, GO:0022890, GO:0022892, GO:0005244, GO:0015075, GO:0022832, GO:0022857, GO:0015267, GO:0022836, GO:0005249, GO:0022839, GO:0022838, GO:0015079
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0071805 [BP]potassium ion transmembrane transportprobableGO:0006810, GO:0071804, GO:0006813, GO:0006812, GO:0006811, GO:0009987, GO:0015672, GO:0008150, GO:0034220, GO:0044765, GO:0044763, GO:0030001, GO:0051179, GO:0051234, GO:0055085, GO:0044699
GO:0005637 [CC]nuclear inner membraneprobableGO:0005575, GO:0016020, GO:0031090, GO:0005623, GO:0031965, GO:0005634, GO:0005635, GO:0019866, GO:0031967, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0044464, GO:0031975, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005516 [MF]calmodulin bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0021576 [BP]hindbrain formationprobableGO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0021575, GO:0044767, GO:0048513, GO:0008150, GO:0048646, GO:0030902, GO:0048731, GO:0009653, GO:0007275, GO:0044699, GO:0007417
GO:0007268 [BP]synaptic transmissionprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0044699, GO:0003008

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F8A, chain A
Confidence level:very confident
Coverage over the Query: 1-67
View the alignment between query and template
View the model in PyMOL
Template: 4F8A, chain A
Confidence level:very confident
Coverage over the Query: 78-127
View the alignment between query and template
View the model in PyMOL