Psyllid ID: psy12115

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
MSKGDVFGDSFWKDNAVGQSAANVRALTYCDLHTIKRDRLLEVLDFYQAFANSFARNLLLTYNLRHRKRDSINLFVSSIISRIPLTYCDLHTIKRDRLLEVLDFYQAFANSFARNLLLTYNLRHRLVSNMTFITLTPKTRLKNSMYIILEERGR
ccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccEEEEEccccccccccccccccccccccccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHccc
cccccccccccccccccccccccEEEEEEccHHHHcHHHHHHHHHHcHHHHHHHHHccEEEEEccccHHcccccHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccccccccccEEEEEEcccc
mskgdvfgdsfwkdnavgqsAANVRALTYCDLHTIKRDRLLEVLDFYQAFANSFARNLLLTYNLRHRKRDSINLFVSSIisripltycdlhtiKRDRLLEVLDFYQAFANSFARNLLLTYNLRHRLVSnmtfitltpktrlknSMYIILEERGR
MSKGDVFGDSFWKDNAVGQSAANVRALTYCDLHTIKRDRLLEVLDFYQAFANSFARNLLLTYNLRHRKRDSINLFVSsiisripltycDLHTIKRDRLLEVLDFYQAFANSFARNLLLTYNLRHRLVSNmtfitltpktrlknsmyiileergr
MSKGDVFGDSFWKDNAVGQSAANVRALTYCDLHTIKRDRLLEVLDFYQAFANSFARNLLLTYNLRHRKRDSINLFVSSIISRIPLTYCDLHTIKRDRLLEVLDFYQAFANSFARNLLLTYNLRHRLVSNMTFITLTPKTRLKNSMYIILEERGR
******FGDSFWKDNAVGQSAANVRALTYCDLHTIKRDRLLEVLDFYQAFANSFARNLLLTYNLRHRKRDSINLFVSSIISRIPLTYCDLHTIKRDRLLEVLDFYQAFANSFARNLLLTYNLRHRLVSNMTFITLTPKTRLKNSMYIIL*****
MSKGDVFGDSFWKDNAVGQSAANVRALTYCDLHTIKRDRLLEVLDFYQAFANSFARNLLLTYNLRHRKRDSI**************************LEVLDFYQAFANSFARNLLLTYNLR*******************************
MSKGDVFGDSFWKDNAVGQSAANVRALTYCDLHTIKRDRLLEVLDFYQAFANSFARNLLLTYNLRHRKRDSINLFVSSIISRIPLTYCDLHTIKRDRLLEVLDFYQAFANSFARNLLLTYNLRHRLVSNMTFITLTPKTRLKNSMYIILEERGR
***GDVFGDSFWKDNAVGQSAANVRALTYCDLHTIKRDRLLEVLDFYQAFANSFARNLLLTYNLRHRK*D***L*VSSIISRIPLTYCDLHTIKRDRLLEVLDFYQAFANSFARNLLLTYNLRHRLVSNMTFITLTPKTRLKNSMYIILEE***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKGDVFGDSFWKDNAVGQSAANVRALTYCDLHTIKRDRLLEVLDFYQAFANSFARNLLLTYNLRHRKRDSINLFVSSIISRIPLTYCDLHTIKRDRLLEVLDFYQAFANSFARNLLLTYNLRHRLVSNMTFITLTPKTRLKNSMYIILEERGR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query154 2.2.26 [Sep-21-2011]
Q02280 1174 Potassium voltage-gated c yes N/A 0.435 0.057 0.880 4e-31
Q60603 989 Potassium voltage-gated c yes N/A 0.435 0.067 0.701 2e-23
O18965 987 Potassium voltage-gated c yes N/A 0.435 0.067 0.701 2e-23
O95259 989 Potassium voltage-gated c yes N/A 0.435 0.067 0.701 3e-23
Q63472 962 Potassium voltage-gated c yes N/A 0.435 0.069 0.701 3e-23
Q9EPI9 988 Potassium voltage-gated c no N/A 0.435 0.067 0.701 1e-22
Q920E3 988 Potassium voltage-gated c no N/A 0.435 0.067 0.701 1e-22
Q8NCM2 988 Potassium voltage-gated c no N/A 0.435 0.067 0.701 2e-22
O54852 1195 Potassium voltage-gated c no N/A 0.474 0.061 0.533 2e-14
Q9ER47 1195 Potassium voltage-gated c no N/A 0.474 0.061 0.52 3e-14
>sp|Q02280|KCNAE_DROME Potassium voltage-gated channel protein eag OS=Drosophila melanogaster GN=eag PE=1 SV=2 Back     alignment and function desciption
 Score =  133 bits (335), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 59/67 (88%), Positives = 63/67 (94%)

Query: 1   MSKGDVFGDSFWKDNAVGQSAANVRALTYCDLHTIKRDRLLEVLDFYQAFANSFARNLLL 60
           + KGDVFGD FWKD+AVGQSAANVRALTYCDLH IKRD+LLEVLDFY AFANSFARNL+L
Sbjct: 628 LGKGDVFGDQFWKDSAVGQSAANVRALTYCDLHAIKRDKLLEVLDFYSAFANSFARNLVL 687

Query: 61  TYNLRHR 67
           TYNLRHR
Sbjct: 688 TYNLRHR 694
Structural component of a potassium channel. Mediates the potassium permeability of membranes; potassium current is regulated by CaMKII and CASK. Has a role in growth of the perineurial glial layer of the larval peripheral nerve.
Drosophila melanogaster (taxid: 7227)
>sp|Q60603|KCNH1_MOUSE Potassium voltage-gated channel subfamily H member 1 OS=Mus musculus GN=Kcnh1 PE=1 SV=1 Back     alignment and function description
>sp|O18965|KCNH1_BOVIN Potassium voltage-gated channel subfamily H member 1 OS=Bos taurus GN=KCNH1 PE=2 SV=2 Back     alignment and function description
>sp|O95259|KCNH1_HUMAN Potassium voltage-gated channel subfamily H member 1 OS=Homo sapiens GN=KCNH1 PE=1 SV=1 Back     alignment and function description
>sp|Q63472|KCNH1_RAT Potassium voltage-gated channel subfamily H member 1 OS=Rattus norvegicus GN=Kcnh1 PE=1 SV=1 Back     alignment and function description
>sp|Q9EPI9|KCNH5_RAT Potassium voltage-gated channel subfamily H member 5 OS=Rattus norvegicus GN=Kcnh5 PE=2 SV=1 Back     alignment and function description
>sp|Q920E3|KCNH5_MOUSE Potassium voltage-gated channel subfamily H member 5 OS=Mus musculus GN=Kcnh5 PE=2 SV=3 Back     alignment and function description
>sp|Q8NCM2|KCNH5_HUMAN Potassium voltage-gated channel subfamily H member 5 OS=Homo sapiens GN=KCNH5 PE=1 SV=3 Back     alignment and function description
>sp|O54852|KCNH7_RAT Potassium voltage-gated channel subfamily H member 7 OS=Rattus norvegicus GN=Kcnh7 PE=1 SV=1 Back     alignment and function description
>sp|Q9ER47|KCNH7_MOUSE Potassium voltage-gated channel subfamily H member 7 OS=Mus musculus GN=Kcnh7 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query154
345497845 1101 PREDICTED: LOW QUALITY PROTEIN: potassiu 0.337 0.047 0.940 2e-31
189236719 1092 PREDICTED: similar to ether a go-go CG10 0.337 0.047 0.940 2e-31
270006159 1059 hypothetical protein TcasGA2_TC008326 [T 0.337 0.049 0.940 3e-31
357614528 1040 Eag K+ channel [Danaus plexippus] 0.435 0.064 0.940 9e-31
328708053 1080 PREDICTED: potassium voltage-gated chann 0.337 0.048 0.910 1e-30
328708049 1069 PREDICTED: potassium voltage-gated chann 0.337 0.048 0.910 1e-30
242010493 1150 voltage-gated channel, putative [Pedicul 0.337 0.045 0.910 1e-30
33327424 1011 Eag K+ channel [Manduca sexta] 0.337 0.051 0.940 2e-30
170033058 1002 potassium voltage-gated channel protein 0.337 0.051 0.910 2e-30
157134827 987 voltage and ligand gated potassium chann 0.337 0.052 0.910 4e-30
>gi|345497845|ref|XP_001605195.2| PREDICTED: LOW QUALITY PROTEIN: potassium voltage-gated channel protein eag-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 63/67 (94%), Positives = 66/67 (98%)

Query: 1   MSKGDVFGDSFWKDNAVGQSAANVRALTYCDLHTIKRDRLLEVLDFYQAFANSFARNLLL 60
           + KGDVFGDSFWKDNAVGQSAANVRALTYCDLHTIKRD+LLEVLDFYQAFANSFARNL+L
Sbjct: 647 LGKGDVFGDSFWKDNAVGQSAANVRALTYCDLHTIKRDKLLEVLDFYQAFANSFARNLIL 706

Query: 61  TYNLRHR 67
           TYNLRHR
Sbjct: 707 TYNLRHR 713

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|189236719|ref|XP_974749.2| PREDICTED: similar to ether a go-go CG10952-PB [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270006159|gb|EFA02607.1| hypothetical protein TcasGA2_TC008326 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357614528|gb|EHJ69134.1| Eag K+ channel [Danaus plexippus] Back     alignment and taxonomy information
>gi|328708053|ref|XP_003243586.1| PREDICTED: potassium voltage-gated channel protein eag-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328708049|ref|XP_003243585.1| PREDICTED: potassium voltage-gated channel protein eag-like isoform 2 [Acyrthosiphon pisum] gi|328708051|ref|XP_001944041.2| PREDICTED: potassium voltage-gated channel protein eag-like isoform 1 [Acyrthosiphon pisum] gi|328708055|ref|XP_003243587.1| PREDICTED: potassium voltage-gated channel protein eag-like isoform 4 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|242010493|ref|XP_002426002.1| voltage-gated channel, putative [Pediculus humanus corporis] gi|212509993|gb|EEB13264.1| voltage-gated channel, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|33327424|gb|AAQ09035.1| Eag K+ channel [Manduca sexta] Back     alignment and taxonomy information
>gi|170033058|ref|XP_001844396.1| potassium voltage-gated channel protein eag [Culex quinquefasciatus] gi|167873510|gb|EDS36893.1| potassium voltage-gated channel protein eag [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157134827|ref|XP_001656462.1| voltage and ligand gated potassium channel [Aedes aegypti] gi|108884339|gb|EAT48564.1| AAEL000466-PA, partial [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query154
FB|FBgn0000535 1174 eag "ether a go-go" [Drosophil 0.435 0.057 0.880 2.6e-27
WB|WBGene00001171 956 egl-2 [Caenorhabditis elegans 0.448 0.072 0.728 1.5e-22
UNIPROTKB|O44164 956 egl-2 "Protein EGL-2" [Caenorh 0.448 0.072 0.728 1.5e-22
UNIPROTKB|J9NSL2699 KCNH1 "Uncharacterized protein 0.532 0.117 0.619 8e-22
UNIPROTKB|F1NHW2 959 KCNH1 "Uncharacterized protein 0.435 0.069 0.701 4.8e-21
UNIPROTKB|E2RSP6738 KCNH1 "Uncharacterized protein 0.435 0.090 0.701 6.4e-21
UNIPROTKB|G3MXF5 960 KCNH1 "Potassium voltage-gated 0.435 0.069 0.701 1e-20
RGD|68398 962 Kcnh1 "potassium voltage-gated 0.435 0.069 0.701 1e-20
UNIPROTKB|Q63472 962 Kcnh1 "Potassium voltage-gated 0.435 0.069 0.701 1e-20
UNIPROTKB|E1BF56 987 KCNH1 "Potassium voltage-gated 0.435 0.067 0.701 1.1e-20
FB|FBgn0000535 eag "ether a go-go" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 319 (117.4 bits), Expect = 2.6e-27, P = 2.6e-27
 Identities = 59/67 (88%), Positives = 63/67 (94%)

Query:     1 MSKGDVFGDSFWKDNAVGQSAANVRALTYCDLHTIKRDRLLEVLDFYQAFANSFARNLLL 60
             + KGDVFGD FWKD+AVGQSAANVRALTYCDLH IKRD+LLEVLDFY AFANSFARNL+L
Sbjct:   628 LGKGDVFGDQFWKDSAVGQSAANVRALTYCDLHAIKRDKLLEVLDFYSAFANSFARNLVL 687

Query:    61 TYNLRHR 67
             TYNLRHR
Sbjct:   688 TYNLRHR 694
GO:0007629 "flight behavior" evidence=IMP
GO:0005249 "voltage-gated potassium channel activity" evidence=IDA;TAS
GO:0008076 "voltage-gated potassium channel complex" evidence=ISS;TAS;IPI
GO:0051259 "protein oligomerization" evidence=IPI
GO:0006813 "potassium ion transport" evidence=IDA;TAS
GO:0005887 "integral to plasma membrane" evidence=NAS
GO:0007619 "courtship behavior" evidence=NAS;TAS
GO:0042066 "perineurial glial growth" evidence=IGI
GO:0008016 "regulation of heart contraction" evidence=NAS
GO:0048150 "behavioral response to ether" evidence=NAS
GO:0007608 "sensory perception of smell" evidence=NAS
GO:0007611 "learning or memory" evidence=NAS
GO:0022843 "voltage-gated cation channel activity" evidence=IDA
GO:0055085 "transmembrane transport" evidence=IEA
GO:0000155 "phosphorelay sensor kinase activity" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0000160 "phosphorelay signal transduction system" evidence=IEA
GO:0007612 "learning" evidence=IMP
GO:0005886 "plasma membrane" evidence=IDA
WB|WBGene00001171 egl-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|O44164 egl-2 "Protein EGL-2" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|J9NSL2 KCNH1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NHW2 KCNH1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2RSP6 KCNH1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|G3MXF5 KCNH1 "Potassium voltage-gated channel subfamily H member 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|68398 Kcnh1 "potassium voltage-gated channel, subfamily H (eag-related), member 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q63472 Kcnh1 "Potassium voltage-gated channel subfamily H member 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BF56 KCNH1 "Potassium voltage-gated channel subfamily H member 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q02280KCNAE_DROMENo assigned EC number0.88050.43500.0570yesN/A
Q60603KCNH1_MOUSENo assigned EC number0.70140.43500.0677yesN/A
O18965KCNH1_BOVINNo assigned EC number0.70140.43500.0678yesN/A
Q63472KCNH1_RATNo assigned EC number0.70140.43500.0696yesN/A
O95259KCNH1_HUMANNo assigned EC number0.70140.43500.0677yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
cd00038115 cd00038, CAP_ED, effector domain of the CAP family 9e-05
>gnl|CDD|237999 cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information 
 Score = 39.2 bits (92), Expect = 9e-05
 Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 2/55 (3%)

Query: 1   MSKGDVFGDSFWKDNAVGQSAANVRALTYCDLHTIKRDRLLEVLDFYQAFANSFA 55
           +  GD+FG+     N  G  +A VRALT  +L  + R     +L  Y   A    
Sbjct: 63  LGPGDLFGELALLGN--GPRSATVRALTDSELLVLPRSDFRRLLQEYPELARRLL 115

In all cases binding of the effector leads to conformational changes and the ability to activate transcription. Cyclic nucleotide-binding domain similar to CAP are also present in cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) and vertebrate cyclic nucleotide-gated ion-channels. Cyclic nucleotide-monophosphate binding domain; proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues; the best studied is the prokaryotic catabolite gene activator, CAP, where such a domain is known to be composed of three alpha-helices and a distinctive eight-stranded, antiparallel beta-barrel structure; three conserved glycine residues are thought to be essential for maintenance of the structural integrity of the beta-barrel; CooA is a homodimeric transcription factor that belongs to CAP family; cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) contain two tandem copies of the cyclic nucleotide-binding domain; cAPK's are composed of two different subunits, a catalytic chain and a regulatory chain, which contains both copies of the domain; cGPK's are single chain enzymes that include the two copies of the domain in their N-terminal section; also found in vertebrate cyclic nucleotide-gated ion-channels. Length = 115

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 154
KOG0501|consensus 971 99.75
KOG0501|consensus 971 99.71
KOG0498|consensus727 99.05
TIGR03697193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 98.15
PF0002791 cNMP_binding: Cyclic nucleotide-binding domain; In 98.01
KOG0500|consensus536 97.99
PLN03192 823 Voltage-dependent potassium channel; Provisional 97.98
COG0664214 Crp cAMP-binding proteins - catabolite gene activa 97.93
PRK11753211 DNA-binding transcriptional dual regulator Crp; Pr 97.91
cd00038115 CAP_ED effector domain of the CAP family of transc 97.88
KOG0499|consensus815 97.82
PRK09392236 ftrB transcriptional activator FtrB; Provisional 97.77
PRK10402226 DNA-binding transcriptional activator YeiL; Provis 97.74
smart00100120 cNMP Cyclic nucleotide-monophosphate binding domai 97.56
KOG0498|consensus 727 97.23
PRK09391230 fixK transcriptional regulator FixK; Provisional 97.18
PRK11161235 fumarate/nitrate reduction transcriptional regulat 97.16
PRK13918202 CRP/FNR family transcriptional regulator; Provisio 96.21
KOG0614|consensus 732 95.27
KOG1113|consensus368 94.76
KOG0614|consensus 732 94.25
PLN02868 413 acyl-CoA thioesterase family protein 92.74
KOG1113|consensus368 91.98
COG2905 610 Predicted signal-transduction protein containing c 91.35
KOG2968|consensus 1158 85.2
>KOG0501|consensus Back     alignment and domain information 
Probab=99.75  E-value=1.2e-19  Score=167.15  Aligned_cols=96  Identities=48%  Similarity=0.737  Sum_probs=85.2

Q ss_pred             cccceeEeEeeeeceEEeehhhHHHHHhhcHHHHHHHhhhhhhhhhcccccccCccccccccccccceeeecceeecCcc
Q psy12115         18 GQSAANVRALTYCDLHTIKRDRLLEVLDFYQAFANSFARNLLLTYNLRHRKRDSINLFVSSIISRIPLTYCDLHTIKRDR   97 (154)
Q Consensus        18 g~rsAsVrALTYCdL~~I~rddl~eVL~~yPefa~~f~~~L~Lt~nLR~~~~~~~~~~~~Ss~s~~~~tyCDlh~i~~~~   97 (154)
                      |+|-.++.-..-..|.+||.|++..+|++...|...||+.-.+.               .|+++++||||||||.|+|+.
T Consensus       586 GESvDaLcFvVsGSLEVIQDDEVVAILGKGDVFGD~FWK~~t~~---------------qs~ANVRALTYcDLH~IKrd~  650 (971)
T KOG0501|consen  586 GESVDALCFVVSGSLEVIQDDEVVAILGKGDVFGDEFWKENTLG---------------QSAANVRALTYCDLHMIKRDK  650 (971)
T ss_pred             CCccceEEEEEecceEEeecCcEEEEeecCccchhHHhhhhhhh---------------hhhhhhhhhhhhhhhHHhHHH
Confidence            45555555566679999999999999999999999999983332               279999999999999999999


Q ss_pred             hHHHhhhhHHHHHHhhhccccccchhhhhhc
Q psy12115         98 LLEVLDFYQAFANSFARNLLLTYNLRHRLVS  128 (154)
Q Consensus        98 L~~vl~~ypef~~~f~~~l~lt~nlr~~~~~  128 (154)
                      |++|||||..||++|.|||.||||||++++.
T Consensus       651 Ll~VLdFYtAFanSFaRNl~LTyNLr~RiiF  681 (971)
T KOG0501|consen  651 LLKVLDFYTAFANSFARNLTLTYNLRHRIIF  681 (971)
T ss_pred             HHHHHHHHHHHHHHhhhceeeEeeccceeee
Confidence            9999999999999999999999999999984

>KOG0501|consensus Back     alignment and domain information
>KOG0498|consensus Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] Back     alignment and domain information
>KOG0500|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>cd00038 CAP_ED effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>KOG0499|consensus Back     alignment and domain information
>PRK09392 ftrB transcriptional activator FtrB; Provisional Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>smart00100 cNMP Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>KOG0498|consensus Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>KOG1113|consensus Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>PLN02868 acyl-CoA thioesterase family protein Back     alignment and domain information
>KOG1113|consensus Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG2968|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
4f8a_A160 Cyclic Nucleotide Binding-Homology Domain From Mous 9e-24
4f8a_A160 Cyclic Nucleotide Binding-Homology Domain From Mous 4e-13
3ukn_A212 Structure Of The C-LinkerCNBHD OF ZELK CHANNELS IN 8e-08
>pdb|4F8A|A Chain A, Cyclic Nucleotide Binding-Homology Domain From Mouse Eag1 Potassium Channel Length = 160 Back     alignment and structure 
Iteration: 1

 Score =  105 bits (263), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 56/67 (83%)
Query: 1   MSKGDVFGDSFWKDNAVGQSAANVRALTYCDLHTIKRDRLLEVLDFYQAFANSFARNLLL 60
           + KGDVFGD FWK+  + QS ANVRALTYCDLH IKRD L +VL+FY AF++SF+RNL+L
Sbjct: 91  LGKGDVFGDVFWKEATLAQSCANVRALTYCDLHVIKRDALQKVLEFYTAFSHSFSRNLIL 150
Query: 61  TYNLRHR 67
           TYNLR R
Sbjct: 151 TYNLRKR 157
>pdb|4F8A|A Chain A, Cyclic Nucleotide Binding-Homology Domain From Mouse Eag1 Potassium Channel Length = 160 Back     alignment and structure
>pdb|3UKN|A Chain A, Structure Of The C-LinkerCNBHD OF ZELK CHANNELS IN C 2 2 21 SPACE Group Length = 212 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 1e-21
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 3e-12
3ukn_A212 Novel protein similar to vertebrate potassium VOL 6e-17
3ukn_A212 Novel protein similar to vertebrate potassium VOL 1e-07
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 4e-10
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 9e-10
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 6e-07
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Length = 160 Back     alignment and structure
 Score = 83.9 bits (208), Expect = 1e-21
 Identities = 47/67 (70%), Positives = 56/67 (83%)

Query: 1   MSKGDVFGDSFWKDNAVGQSAANVRALTYCDLHTIKRDRLLEVLDFYQAFANSFARNLLL 60
           + KGDVFGD FWK+  + QS ANVRALTYCDLH IKRD L +VL+FY AF++SF+RNL+L
Sbjct: 91  LGKGDVFGDVFWKEATLAQSCANVRALTYCDLHVIKRDALQKVLEFYTAFSHSFSRNLIL 150

Query: 61  TYNLRHR 67
           TYNLR R
Sbjct: 151 TYNLRKR 157
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Length = 160 Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Length = 212 Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Length = 212 Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Length = 202 Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Length = 198 Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Length = 137 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query154
3ukn_A212 Novel protein similar to vertebrate potassium VOL 99.18
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 99.11
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 98.91
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 98.87
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 98.82
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 98.67
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 98.66
2pqq_A149 Putative transcriptional regulator; APC7345, strep 98.62
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 98.61
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 98.53
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 98.5
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 98.49
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 98.48
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 98.44
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 98.42
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 98.42
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 98.41
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 98.4
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 98.38
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 98.38
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 98.36
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 98.35
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 98.32
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 98.32
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 98.3
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 98.3
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 98.29
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 98.29
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 98.28
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 98.26
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 98.26
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 98.23
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 98.23
4ava_A 333 Lysine acetyltransferase; allosteric regulation, d 98.21
4din_B381 CAMP-dependent protein kinase type I-beta regulat 98.2
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 98.16
3dn7_A194 Cyclic nucleotide binding regulatory protein; stru 98.16
3e6c_C250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 98.13
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 98.06
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 98.03
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 98.01
4din_B381 CAMP-dependent protein kinase type I-beta regulat 98.0
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 97.96
1ft9_A222 Carbon monoxide oxidation system transcription reg 97.92
3b02_A195 Transcriptional regulator, CRP family; structural 97.86
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 97.84
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 97.75
2bgc_A238 PRFA; bacterial infection, human pathogen, transcr 97.72
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 97.52
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 97.48
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 97.14
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 97.13
3cf6_E 694 RAP guanine nucleotide exchange factor (GEF) 4; EP 96.54
3ukn_A212 Novel protein similar to vertebrate potassium VOL 96.51
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 90.7
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 89.76
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 87.15
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 80.7
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Back     alignment and structure
Probab=99.18  E-value=1.9e-11  Score=93.81  Aligned_cols=69  Identities=42%  Similarity=0.675  Sum_probs=60.7

Q ss_pred             CCCCCcccccCCCCCCCcccceeEeEeeeeceEEeehhhHHHHHhhcHHHHHHHhhhh--hhhhhcccccc
Q psy12115          1 MSKGDVFGDSFWKDNAVGQSAANVRALTYCDLHTIKRDRLLEVLDFYQAFANSFARNL--LLTYNLRHRKR   69 (154)
Q Consensus         1 LGkGD~FGE~~~l~~~~g~rsAsVrALTYCdL~~I~rddl~eVL~~yPefa~~f~~~L--~Lt~nLR~~~~   69 (154)
                      +++||+|||..++.+...++.++|+|+|+|.+.+|++++|.++++.||+++..|.+.+  .|+++||+.+.
T Consensus       139 l~~G~~fGe~~~~~~~~~~~~~~v~a~~~~~l~~i~~~~f~~ll~~~p~~~~~~~~~l~~~l~~~lr~~~~  209 (212)
T 3ukn_A          139 LGKGDLIGSDSLTKEQVIKTNANVKALTYCDLQYISLKGLREVLRLYPEYAQKFVSEIQHDLTYNLREGSG  209 (212)
T ss_dssp             ECTTCEEECSCCSSSSCCBBCSEEEESSCEEEEEEEHHHHHHHHHHCHHHHHHHHHHHHHHEEEECBC---
T ss_pred             ecCCCCcCcHHhccCCCCCcceEEEEcccEEEEEEeHHHHHHHHHHChHHHHHHHHHHHHhhccccccccc
Confidence            5899999999999874337999999999999999999999999999999999999998  68888888654
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Back     alignment and structure
>3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 154
d1wgpa_137 b.82.3.2 (A:) Probable cyclic nucleotide-gated ion 0.003
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 137 Back     information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: Probable cyclic nucleotide-gated ion channel 6
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 34.1 bits (77), Expect = 0.003
 Identities = 12/55 (21%), Positives = 21/55 (38%), Gaps = 7/55 (12%)

Query: 1   MSKGDVFGDSFWKDNAVGQSAA-------NVRALTYCDLHTIKRDRLLEVLDFYQ 48
           + +GD  GD         +S +        V+ALT  +   +  D L  V   ++
Sbjct: 76  LKEGDFCGDELLTWALDPKSGSNLPSSTRTVKALTEVEAFALIADELKFVASQFR 130

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query154
d1q3ea_193 HCN pacemaker channel {Mouse (Mus musculus) [TaxId 98.83
d1wgpa_137 Probable cyclic nucleotide-gated ion channel 6 {Th 98.71
d1ne6a1136 Regulatory subunit of Protein kinase A {Cow (Bos t 98.57
d1vp6a_133 Putative ion channel CnbD {Mesorhizobium loti [Tax 98.55
d1cx4a2147 Regulatory subunit of Protein kinase A {Rat (Rattu 98.54
d2oz6a2134 Cyclic AMP receptor-like protein Vfr {Pseudomonas 98.5
d1o7fa2155 Regulatory domain of Epac2, domains 1 and 3 {Mouse 98.43
d2gaua2142 Transcriptional regulator PG0396, N-terminal domai 98.4
d1o7fa3124 Regulatory domain of Epac2, domains 1 and 3 {Mouse 98.38
d1ne6a2132 Regulatory subunit of Protein kinase A {Cow (Bos t 98.35
d1i5za2132 Catabolite gene activator protein, N-terminal doma 98.34
d1o5la1129 CRP-like transcriptional regulator TM1171, N-termi 98.29
d1zyba2147 Probable transcription regulator BT4300, N-termina 98.21
d1cx4a1136 Regulatory subunit of Protein kinase A {Rat (Rattu 98.17
d3e5ua2139 Chlorophenol reduction protein CprK {Desulfitobact 98.09
d1ft9a2132 CO-sensing protein CooA, N-terminal domain {Rhodos 98.09
d2zcwa2112 Transcriptional regulator TTHA1359, N-terminal dom 97.4
d1q3ea_193 HCN pacemaker channel {Mouse (Mus musculus) [TaxId 90.01
d1vp6a_133 Putative ion channel CnbD {Mesorhizobium loti [Tax 84.25
d1wgpa_137 Probable cyclic nucleotide-gated ion channel 6 {Th 81.55
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: HCN pacemaker channel
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=98.83  E-value=4.5e-10  Score=84.24  Aligned_cols=55  Identities=35%  Similarity=0.573  Sum_probs=51.6

Q ss_pred             CCCCCcccccCCCCCCCcccceeEeEeeeeceEEeehhhHHHHHhhcHHHHHHHhhh
Q psy12115          1 MSKGDVFGDSFWKDNAVGQSAANVRALTYCDLHTIKRDRLLEVLDFYQAFANSFARN   57 (154)
Q Consensus         1 LGkGD~FGE~~~l~~~~g~rsAsVrALTYCdL~~I~rddl~eVL~~yPefa~~f~~~   57 (154)
                      |++||+|||..++.+  .++.++|+|+|+|++.+|++++|.++++.||+++..|.+.
T Consensus       132 l~~G~~fGe~~~~~~--~~~~~~~~a~~~~~l~~l~~~~f~~ll~~~p~~~~~~~~~  186 (193)
T d1q3ea_         132 LSDGSYFGEICLLTR--GRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETV  186 (193)
T ss_dssp             ECTTCEECHHHHHHC--SBCSSEEEESSCEEEEEEEHHHHHHHHHHSGGGHHHHHHH
T ss_pred             eccceeeeeeeccCC--CcccccceecCceEEEEEeHHHHHHHHHHCHHHHHHHHHH
Confidence            579999999999988  5689999999999999999999999999999999999876
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure