Diaphorina citri psyllid: psy12129


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
MDKGSRPSEELGYQSGNMAGEMWLQWFSCCINQPTAPQRKRHQVRRPMRIDRSMIGEPTNFQHTGHIGSGDVELGNSRLRAIQNQMQSKGGYEADLGVRVSARQTHTRSQRRYRKEDPNGSDSSGDVELGNSRLRAIQNQMQSKGGYEADLGVR
ccccccccccccHccccccHHHHHHHHccccccccccccccccccccccccccccccccccEEEcccccccccccccHHHHHHHHHHHccccccccccHHHHEEHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHcccccccccccc
*****************MAGEMWLQWFSCCIN********************SMIGEPTNFQHTGHIGSGD***************************RVSARQT********************************************DLGV*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDKGSRPSEELGYQSGNMAGEMWLQWFSCCINQPTAPQRKRHQVRRPMRIDRSMIGEPTNFQHTGHIGSGDVELGNSRLRAIQNQMQSKGGYEADLGVRVSARQTHTRSQRRYRKEDPNGSDSSGDVELGNSRLRAIQNQMQSKGGYEADLGVR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
CDC42 small effector protein 2 Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly. Alters CDC42-induced cell shape changes. In activated T-cells, may play a role in CDC42-mediated F-actin accumulation at the immunological synapse. May play a role in early contractile events in phagocytosis in macrophages.confidentQ5R4F8
CDC42 small effector protein homolog Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly.confidentQ9VNE7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1CEE, chain B
Confidence level:confident
Coverage over the Query: 47-85
View the alignment between query and template
View the model in PyMOL