Diaphorina citri psyllid: psy12131

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-----

EKEIELLYNRESLDLDRVTLKLAGLYQCIASNNIGESTSKNFIVNVIYPPEVSVEKQWIHTAPDMRAEIICNVYANPPAKVEWFRDGTAITLGGRIDMHVSSEKHSLLVRHIKDTDFGNYMCQASNNLGSSQQFIQLSGIPNIPVFQKSSRRLGPDGYRLVWQVDTYSGIIQYLLKFREREELTPWRNIVIPSDGSLAGPIYTQSYNITGLQLFTQYEASVLAKNRFGWSRPSKAYVFATEGAET

cccEEEECcccEEEEEEccccccEEEEEEEEccccccccEEEEEEEccccCEECcccCEEEcccccEEEEEEEEECcccEEEEEEccCECccccCEEEEEEccEEEEEEccccccccEEEEEEEEccccCEEEEEEEEEcccccccccccccccccEEEEEEEEcccccccEEEEEEECccccccCEEEECcccccccccCEEEEEEEcccccccEEEEEEEEEcccccccccccEEEEcccccc

**EIELLYNRESLDLDRVTLKLAGLYQCIASNNIGESTSKNFIVNVIYPPEVSVEKQWIHTAPDMRAEIICNVYANPPAKVEWFRDGTAITLGGRIDMHVSSEKHSLLVRHIKDTDFGNYMCQASNNLGSSQQFIQLSGIPNIPVFQKS***LGPDGYRLVWQVDTYSGIIQYLLKFREREELTPWRNIVIPSDGSLAGPIYTQSYNITGLQLFTQYEASVLAKNRFGWSRPSKAYVFA******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0071944 [CC]	cell periphery	probable	GO:0005575, GO:0044464, GO:0005623
GO:0044763 [BP]	single-organism cellular process	probable	GO:0009987, GO:0008150, GO:0044699
GO:0042802 [MF]	identical protein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0033267 [CC]	axon part	probable	GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0005622 [CC]	intracellular	probable	GO:0005575, GO:0044464, GO:0005623

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3B43, chain A
Confidence level:very confident
Coverage over the Query: 5-240
View the alignment between query and template
View the model in PyMOL