Diaphorina citri psyllid: psy12132


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120------
MHSITAPDMRAEIICNVYANPPAKVEWFRDGTAITLGGRIDMHVSSEKHSLLVRHIKDTDFGNYMCQASNNLGSSQQFIQLSGIPNIPVFQKSSRRLGPDGYRLVWQVDTYSAIIQYLLKFREREG
ccEEccccccEEEEEEEEECcccEEEEEEccEEccccccEEEEEcccEEEEEEccccccccCEEEEEEEEcccCEEEEEEEEEccccccccccccCEcccCEEEEEEEcccccccEEEEEEEEccc
MHSITAPDMRAEIICNVYANPPAKVEWFRDGTAITLGGRIDMHVSSEKHSLLVRHIKDTDFGNYMCQASNNLGSSQQFIQLSGIPNIPVFQKSSRRLGPDGYRLVWQVDTYSAIIQYLLKFRERE*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHSITAPDMRAEIICNVYANPPAKVEWFRDGTAITLGGRIDMHVSSEKHSLLVRHIKDTDFGNYMCQASNNLGSSQQFIQLSGIPNIPVFQKSSRRLGPDGYRLVWQVDTYSAIIQYLLKFREREG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0030018 [CC]Z discprobableGO:0005737, GO:0005575, GO:0043229, GO:0043232, GO:0044464, GO:0031674, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0043167 [MF]ion bindingprobableGO:0003674, GO:0005488
GO:0033267 [CC]axon partprobableGO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0015629 [CC]actin cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0051716 [BP]cellular response to stimulusprobableGO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0044430 [CC]cytoskeletal partprobableGO:0005856, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0045202 [CC]synapseprobableGO:0005575
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0048699 [BP]generation of neuronsprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0009987, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699
GO:0005578 [CC]proteinaceous extracellular matrixprobableGO:0005575, GO:0005576, GO:0044421, GO:0031012
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0030054 [CC]cell junctionprobableGO:0005575
GO:0031672 [CC]A bandprobableGO:0005737, GO:0005575, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0030426 [CC]growth coneprobableGO:0030427, GO:0044463, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3V2A, chain R
Confidence level:very confident
Coverage over the Query: 6-80
View the alignment between query and template
View the model in PyMOL
Template: 3V2A, chain R
Confidence level:very confident
Coverage over the Query: 3-88
View the alignment between query and template
View the model in PyMOL