Diaphorina citri psyllid: psy12136


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------40
MFKANVSDTEQPIVIPIRKIASGGSVKLEPQSFPRPTSPVDSEKFSSSATVRSSPLMSRHTLPLTVNENSISPVSPLSPICNGNFNTQQESSGTLKRGVITEEKEYFVTSQADTNLGSIELTVTYDSTTCSLHVTLHRAKGLRAMDIHGTSDPFCKLNLVPLTKTSHRLRTKTCLRTINPEFHEKLTFYSVSETDLSLQSLHILVLDDDKYGHDFLGEARFPLNRLRPHISRDLCLNLCKHYPVPREEEVWGEEECWQHGKIFLTLCFSTKKRALIVNLIKCTNLIPMDSNGFSDPFIKLYLKPDLHKRKYKTGVKWKTLNPIFNEEFAIETKITELSKQTLVITVWDKDYGKSNDYLGCLELCCNSKGDRLRHWVDMMKYPDHKHEGIHNLSIKPLSS
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCEEEEEEEEcccccEEEEEEEEcccccccccccccccEEEEEECcccccccCECcccECcccccCCccEEEEccccccHHcccEEEEEEEEcccccccccEEEEEEcccccccccccEEEEcccccccccccccccccccccccEEEEEEEEEccccEEEEEEEccccccccccccccccEEEEEECccccCEEEcccccccccccccccEEEEEcccccccccEEEEEEEEccccccccEEEEEEEccccccHHHHHHHHHHHcccccEEEECccccccccc
**************I***********************************************************************************************QADTNLGSIELTVTYDSTTCSLHVTLHRAKGLRAMDIHGTSDPFCKLNLVPLTKTSHRLRTKTCLRTINPEFHEKLTFYSVSETDLSLQSLHILVLDDDKYGHDFLGEARFPLNRLRPHISRDLCLNLCKHYPV************WQHGKIFLTLCFSTKKRALIVNLIKCTNLIPMDSNGFSDPFIKLYLKPDLHKRKYKTGVKWKTLNPIFNEEFAIETKITELSKQTLVITVWDKDYGKSNDYLGCLELCCNSKGDRLRHWVDMMKYPDHKHEGIHN*SIK****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFKANVSDTEQPIVIPIRKIASGGSVKLEPQSFPRPTSPVDSEKFSSSATVRSSPLMSRHTLPLTVNENSISPVSPLSPICNGNFNTQQESSGTLKRGVITEEKEYFVTSQADTNLGSIELTVTYDSTTCSLHVTLHRAKGLRAMDIHGTSDPFCKLNLVPLTKTSHRLRTKTCLRTINPEFHEKLTFYSVSETDLSLQSLHILVLDDDKYGHDFLGEARFPLNRLRPHISRDLCLNLCKHYPVPREEEVWGEEECWQHGKIFLTLCFSTKKRALIVNLIKCTNLIPMDSNGFSDPFIKLYLKPDLHKRKYKTGVKWKTLNPIFNEEFAIETKITELSKQTLVITVWDKDYGKSNDYLGCLELCCNSKGDRLRHWVDMMKYPDHKHEGIHNLSIKPLSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Double C2-like domain-containing protein beta Calcium sensor which positively regulates SNARE-dependent fusion of vesicles with membranes. Binds phospholipids in a calcium-dependent manner and may act at the priming stage of fusion by modifying membrane curvature to stimulate fusion. Involved in calcium-triggered exocytosis in chromaffin cells and calcium-dependent spontaneous release of neurotransmitter in absence of action potentials in neuronal cells. Involved both in glucose-stimulated insulin secretion in pancreatic cells and insulin-dependent GLUT4 transport to the plasma membrane in adipocytes.confidentP70610
Double C2-like domain-containing protein beta Calcium sensor which positively regulates SNARE-dependent fusion of vesicles with membranes. Binds phospholipids in a calcium-dependent manner and may act at the priming stage of fusion by modifying membrane curvature to stimulate fusion. Involved in calcium-triggered exocytosis in chromaffin cells and calcium-dependent spontaneous release of neurotransmitter in absence of action potentials in neuronal cells. Involved both in glucose-stimulated insulin secretion in pancreatic cells and insulin-dependent GLUT4 transport to the plasma membrane in adipocytes.confidentP70169
Double C2-like domain-containing protein beta Calcium sensor which positively regulates SNARE-dependent fusion of vesicles with membranes. Binds phospholipids in a calcium-dependent manner and may act at the priming stage of fusion by modifying membrane curvature to stimulate fusion. Involved in calcium-triggered exocytosis in chromaffin cells and calcium-dependent spontaneous release of neurotransmitter in absence of action potentials in neuronal cells. Involved both in glucose-stimulated insulin secretion in pancreatic cells and insulin-dependent GLUT4 transport to the plasma membrane in adipocytes.confidentQ14184

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005544 [MF]calcium-dependent phospholipid bindingprobableGO:0043168, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488
GO:0030276 [MF]clathrin bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0017075 [MF]syntaxin-1 bindingprobableGO:0003674, GO:0000149, GO:0019905, GO:0005488, GO:0005515
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0050796 [BP]regulation of insulin secretionprobableGO:0090087, GO:0032879, GO:0060341, GO:0051046, GO:0002791, GO:0050794, GO:0008150, GO:0090276, GO:0046883, GO:0051049, GO:0023051, GO:0065007, GO:0010646, GO:0050789
GO:0016079 [BP]synaptic vesicle exocytosisprobableGO:0019226, GO:0003001, GO:0035637, GO:0051648, GO:0007268, GO:0032940, GO:0032501, GO:0023052, GO:0001505, GO:0051656, GO:0051650, GO:0044699, GO:0048489, GO:0006887, GO:0065007, GO:0051640, GO:0097479, GO:0065008, GO:0009987, GO:0050877, GO:0003008, GO:0006810, GO:0023061, GO:0044765, GO:0044763, GO:0007269, GO:0051649, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0097480, GO:0051641, GO:0044700, GO:0046903, GO:0016192, GO:0044707, GO:0008150, GO:0006836
GO:0005509 [MF]calcium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0045956 [BP]positive regulation of calcium ion-dependent exocytosisprobableGO:0045921, GO:0060341, GO:0051046, GO:0051047, GO:0051049, GO:0051050, GO:0060627, GO:0017158, GO:0065007, GO:0048518, GO:0008150, GO:0032879, GO:0017157, GO:0050789, GO:0050794, GO:0048522
GO:0045955 [BP]negative regulation of calcium ion-dependent exocytosisprobableGO:0045920, GO:0032879, GO:0051046, GO:0051051, GO:0051048, GO:0051049, GO:0060341, GO:0060627, GO:0017158, GO:0065007, GO:0008150, GO:0048519, GO:0050794, GO:0050789, GO:0048523, GO:0017157
GO:0031045 [CC]dense core granuleprobableGO:0005737, GO:0043231, GO:0016023, GO:0030141, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0031410, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0050750 [MF]low-density lipoprotein particle receptor bindingprobableGO:0070325, GO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0005764 [CC]lysosomeprobableGO:0005737, GO:0000323, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0031340 [BP]positive regulation of vesicle fusionprobableGO:0031338, GO:0051130, GO:0032879, GO:0051050, GO:0051049, GO:0033043, GO:0010638, GO:0060627, GO:0051128, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0050789, GO:0048522
GO:0005546 [MF]phosphatidylinositol-4,5-bisphosphate bindingprobableGO:0043168, GO:0035091, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:1901981
GO:0048278 [BP]vesicle dockingprobableGO:0006810, GO:0016192, GO:0009987, GO:0022406, GO:0044763, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0030285 [CC]integral to synaptic vesicle membraneprobableGO:0008021, GO:0030135, GO:0043229, GO:0031301, GO:0045202, GO:0043227, GO:0043226, GO:0031224, GO:0030136, GO:0030665, GO:0044446, GO:0031090, GO:0030662, GO:0016023, GO:0031410, GO:0016021, GO:0016020, GO:0031988, GO:0044433, GO:0044456, GO:0005737, GO:0030659, GO:0012505, GO:0012506, GO:0031982, GO:0030672, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422, GO:0031300
GO:0060076 [CC]excitatory synapseprobableGO:0005575, GO:0045202
GO:0001786 [MF]phosphatidylserine bindingprobableGO:0043168, GO:0072341, GO:0005543, GO:0031406, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:0016597
GO:0005516 [MF]calmodulin bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0001778 [BP]plasma membrane repairprobableGO:0016044, GO:0050896, GO:0009987, GO:0007009, GO:0042060, GO:0009611, GO:0061024, GO:0006950, GO:0044763, GO:0016043, GO:0071840, GO:0008150, GO:0044699
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0015630 [CC]microtubule cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0031201 [CC]SNARE complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0016020, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425
GO:0050804 [BP]regulation of synaptic transmissionprobableGO:0044057, GO:0031644, GO:0050794, GO:0065007, GO:0051239, GO:0023051, GO:0008150, GO:0051969, GO:0010646, GO:0050789
GO:0042734 [CC]presynaptic membraneprobableGO:0097060, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0044456, GO:0045202
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1DQV, chain A
Confidence level:very confident
Coverage over the Query: 114-241,253-396
View the alignment between query and template
View the model in PyMOL