Diaphorina citri psyllid: psy12140


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170---
MSSSTSDGSWVNTHWAIRAGIFDVVPASCLENLTPEDFRLLLNGVGDINVTVLISYTSFIDESGEPSERLIKFKRWLWSIVEKMTHLERMDLGCAIAIRAGIFDVVPASCLENLTPEDFRLLLNGVGDINVTVLISYTSFIDESGEPSERLIKFKRWLWSIVEKMTHLERMDL
cccccccccHHHHHHHHHHcccccccHHHHcccccHHHHHHHcccccccHHHHHcccEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHccccccccHHHHHHccEEcccccccHHHHHHHHHHHHHHHHHccHHHHHcc
*********WVNTHWAIRAGIFDVVPASCLENLTPEDFRLLLNGVGDINVTVLISYTSFIDESGEPSERLIKFKRWLWSIVEKMTHLERMDLGCAIAIRAGIFDVVPASCLENLTPEDFRLLLNGVGDINVTVLISYTSFIDESGEPSERLIKFKRWLWSIVEKMTHL**MD*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSSTSDGSWVNTHWAIRAGIFDVVPASCLENLTPEDFRLLLNGVGDINVTVLISYTSFIDESGEPSERLIKFKRWLWSIVEKMTHLERMDLGCAIAIRAGIFDVVPASCLENLTPEDFRLLLNGVGDINVTVLISYTSFIDESGEPSERLIKFKRWLWSIVEKMTHLERMDL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
E3 ubiquitin-protein ligase hyd E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates (By similarity). Required for regulation of cell proliferation in imaginal disks and germ cells. Acts as a negative regulator of hh, ci and dpp expression in the anterior of the eye disk.confidentP51592
E3 ubiquitin-protein ligase UBR5 E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation. Involved in maturation and/or transcriptional regulation of mRNA by activating CDK9 by polyubiquitination. May play a role in control of cell cycle progression. May have tumor suppressor function. Plays an essential role in extraembryonic development. Regulates DNA topoisomerase II binding protein (TopBP1) for the DNA damage response.confidentQ80TP3
E3 ubiquitin-protein ligase UBR5 E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation (By similarity). Involved in maturation and/or transcriptional regulation of mRNA by activating CDK9 by polyubiquitination. May play a role in control of cell cycle progression. May have tumor suppressor function. Regulates DNA topoisomerase II binding protein (TopBP1) for the DNA damage response. Plays an essential role in extraembryonic development.confidentQ62671

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0050847 [BP]progesterone receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0030522, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0030518, GO:0007154, GO:0050789, GO:0044699
GO:0090263 [BP]positive regulation of canonical Wnt receptor signaling pathwayprobableGO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0030111, GO:0050794, GO:0023056, GO:0030177, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0060828, GO:0048522
GO:0000209 [BP]protein polyubiquitinationprobableGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0033160 [BP]positive regulation of protein import into nucleus, translocationprobableGO:0033157, GO:0070201, GO:0032879, GO:0032388, GO:0060341, GO:0051050, GO:0051049, GO:0032386, GO:1900180, GO:0090316, GO:0033158, GO:0050794, GO:0008150, GO:0065007, GO:0046822, GO:0048518, GO:0042306, GO:0051222, GO:0051223, GO:0050789, GO:0032880
GO:0035413 [BP]positive regulation of catenin import into nucleusprobableGO:0033157, GO:0032388, GO:0060341, GO:0051049, GO:0032386, GO:0035412, GO:0051222, GO:0051223, GO:0050789, GO:0032880, GO:0065007, GO:0048518, GO:0070201, GO:0051050, GO:0090316, GO:0050794, GO:0008150, GO:0042307, GO:0042306, GO:0032879, GO:1900180, GO:0046824, GO:0046822
GO:0034450 [MF]ubiquitin-ubiquitin ligase activityprobableGO:0019787, GO:0016879, GO:0004842, GO:0016881, GO:0003824, GO:0003674, GO:0016874

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PT3, chain A
Confidence level:very confident
Coverage over the Query: 56-104,115-150
View the alignment between query and template
View the model in PyMOL
Template: 1C4Z, chain A
Confidence level:very confident
Coverage over the Query: 8-163
View the alignment between query and template
View the model in PyMOL