Diaphorina citri psyllid: psy12153


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230------
MTGDVCDEIDCVNGEPVLLWHLYHHECKWNAAVVTLYFLGVILGSIPAGLLADRFGRRVIMLISFYGQGAISIAIVYNRSFPVYLILRTMQGFFVQGLQNSTYTLLIELFPTRWRIGVATYTLLIELFPTRWRIGVAWVTEICWTVGLVMLSLVSYWFPNWRDAELVTSLPFVGFSLFYVWFIPESPLWKYTKNKIIDFEYLCDDESHREASLNDYSQGSRPALNKGECFIAVFIS
ccccEEEcccccccCEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHcHHHHHHccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccEEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHcccHHHHHHHHHHHHHHccccccccccccccccccccccccccc
*TGDVCDEIDCVNGEPVLLWHLYHHECKWNAAVVTLYFLGVILGSIPAGLLADRFGRRVIMLISFYGQGAISIAIVYNRSFPVYLILRTMQGFFVQGLQNSTYTLLIELFPTRWRIGVATYTLLIELFPTRWRIGVAWVTEICWTVGLVMLSLVSYWFPNWRDAELVTSLPFVGFSLFYVWFIPESPLWKYTKNKIIDFEYLCDDESHR********************FIAVFIS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTGDVCDEIDCVNGEPVLLWHLYHHECKWNAAVVTLYFLGVILGSIPAGLLADRFGRRVIMLISFYGQGAISIAIVYNRSFPVYLILRTMQGFFVQGLQNSTYTLLIELFPTRWRIGVATYTLLIELFPTRWRIGVAWVTEICWTVGLVMLSLVSYWFPNWRDAELVTSLPFVGFSLFYVWFIPESPLWKYTKNKIIDFEYLCDDESHREASLNDYSQGSRPALNKGECFIAVFIS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044425 [CC]membrane partprobableGO:0005575, GO:0016020
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0015651 [MF]quaternary ammonium group transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005215, GO:0008324, GO:0015075, GO:0022857, GO:0015101, GO:0003674
GO:0006812 [BP]cation transportprobableGO:0006811, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:1901618 [MF]organic hydroxy compound transmembrane transporter activityprobableGO:0005215, GO:0022857, GO:0003674
GO:0034220 [BP]ion transmembrane transportprobableGO:0009987, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0044763, GO:0008150, GO:0051234, GO:0055085, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PW4, chain A
Confidence level:very confident
Coverage over the Query: 16-115,134-189
View the alignment between query and template
View the model in PyMOL