Psyllid ID: psy12153


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230------
MTGDVCDEIDCVNGEPVLLWHLYHHECKWNAAVVTLYFLGVILGSIPAGLLADRFGRRVIMLISFYGQGAISIAIVYNRSFPVYLILRTMQGFFVQGLQNSTYTLLIELFPTRWRIGVATYTLLIELFPTRWRIGVAWVTEICWTVGLVMLSLVSYWFPNWRDAELVTSLPFVGFSLFYVWFIPESPLWKYTKNKIIDFEYLCDDESHREASLNDYSQGSRPALNKGECFIAVFIS
ccccEEEcccccccEEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHcHHHHHHccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccEEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHcccHHHHHHHHHHHHHHccccccccccccccccccccccccccc
ccccEEEccccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHEEEEEEEEEEcccHHHHHHHHHHHHHHHHccccHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccHHHHHHHHHHHHHHcccccccccccHHHHHHcccccccHcc
mtgdvcdeidcvngepvLLWHLYHHECKWNAAVVTLYFLGVILGsipaglladRFGRRVIMLISFYGQGAISIAIVYNRSFPVYLILRTMQGFFVQGLQNSTYTLLIELFPTRWRIGVATYTLLIELFPTRWRIGVAWVTEICWTVGLVMLSLVSYwfpnwrdaelvtslpfvgfSLFYvwfipesplwkytknkiidfeylcddeshreaslndysqgsrpalnkgeCFIAVFIS
MTGDVCDEIDCVNGEPVLLWHLYHHECKWNAAVVTLYFLGVILGSIPAGLLADRFGRRVIMLISFYGQGAISIAIVYNRSFPVYLILRTMQGFFVQGLQNSTYTLLIELFPTRWRIGVATYTLLIELFPTRWRIGVAWVTEICWTVGLVMLSLVSYWFPNWRDAELVTSLPFVGFSLFYVWFIPESPLWKYTKNKIIDFEYLCDDESHREASLndysqgsrpalnkgECFIAVFIS
MTGDVCDEIDCVNGEPVLLWHLYHHECKWNAAVVTLYFLGVILGSIPAGLLADRFGRRVIMLISFYGQGAISIAIVYNRSFPVYLILRTMQGFFVQGLQNSTYTLLIELFPTRWRIGVATYTLLIELFPTRWRIGVAWVTEICWTVGLVMLSLVSYWFPNWRDAELVTSLPFVGFSLFYVWFIPESPLWKYTKNKIIDFEYLCDDESHREASLNDYSQGSRPALNKGECFIAVFIS
****VCDEIDCVNGEPVLLWHLYHHECKWNAAVVTLYFLGVILGSIPAGLLADRFGRRVIMLISFYGQGAISIAIVYNRSFPVYLILRTMQGFFVQGLQNSTYTLLIELFPTRWRIGVATYTLLIELFPTRWRIGVAWVTEICWTVGLVMLSLVSYWFPNWRDAELVTSLPFVGFSLFYVWFIPESPLWKYTKNKIIDFEYLCDD********************KGECFIAVFI*
*TGDVCDEIDCVNGEPVLLWHLYHHECKWNAAVVTLYFLGVILGSIPAGLLADRFGRRVIMLISFYGQGAISIAIVYNRSFPVYLILRTMQGFFVQGLQNSTYTLLIELFPTRWRIGVATYTLLIELFPTRWRIGVAWVTEICWTVGLVMLSLVSYWFPNWRDAELVTSLPFVGFSLFYVWFIPESPLWKYTKNKIIDFEYLCDDESHR********************FIAVFIS
MTGDVCDEIDCVNGEPVLLWHLYHHECKWNAAVVTLYFLGVILGSIPAGLLADRFGRRVIMLISFYGQGAISIAIVYNRSFPVYLILRTMQGFFVQGLQNSTYTLLIELFPTRWRIGVATYTLLIELFPTRWRIGVAWVTEICWTVGLVMLSLVSYWFPNWRDAELVTSLPFVGFSLFYVWFIPESPLWKYTKNKIIDFEYLCDDESHREASLNDYSQGSRPALNKGECFIAVFIS
*TGDVCDEIDCVNGEPVLLWHLYHHECKWNAAVVTLYFLGVILGSIPAGLLADRFGRRVIMLISFYGQGAISIAIVYNRSFPVYLILRTMQGFFVQGLQNSTYTLLIELFPTRWRIGVATYTLLIELFPTRWRIGVAWVTEICWTVGLVMLSLVSYWFPNWRDAELVTSLPFVGFSLFYVWFIPESPLWKYTKNKIIDFEYLCDDESHREA*******G*****************
oooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTGDVCDEIDCVNGEPVLLWHLYHHECKWNAAVVTLYFLGVILGSIPAGLLADRFGRRVIMLISFYGQGAISIAIVYNRSFPVYLILRTMQGFFVQGLQNSTYTLLIELFPTRWRIGVATYTLLIELFPTRWRIGVAWVTEICWTVGLVMLSLVSYWFPNWRDAELVTSLPFVGFSLFYVWFIPESPLWKYTKNKIIDFEYLCDDESHREASLNDYSQGSRPALNKGECFIAVFIS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query236 2.2.26 [Sep-21-2011]
O77504 554 Solute carrier family 22 yes N/A 0.661 0.281 0.314 1e-16
A7MBE0 563 Solute carrier family 22 yes N/A 0.661 0.277 0.314 4e-16
O57379 562 Solute carrier family 22 N/A N/A 0.665 0.279 0.312 9e-16
Q9WTW5 551 Solute carrier family 22 yes N/A 0.584 0.250 0.312 1e-15
Q8MJI6 554 Solute carrier family 22 no N/A 0.724 0.308 0.303 1e-15
O88446 551 Solute carrier family 22 yes N/A 0.584 0.250 0.305 2e-15
A6QLW8 547 Solute carrier family 22 no N/A 0.762 0.329 0.288 3e-15
O75751 556 Solute carrier family 22 yes N/A 0.584 0.248 0.331 8e-15
O08966 556 Solute carrier family 22 no N/A 0.584 0.248 0.324 9e-15
Q63089 556 Solute carrier family 22 no N/A 0.716 0.303 0.288 9e-15
>sp|O77504|S22A1_RABIT Solute carrier family 22 member 1 OS=Oryctolagus cuniculus GN=SLC22A1 PE=1 SV=1 Back     alignment and function desciption
 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 85/175 (48%), Gaps = 19/175 (10%)

Query: 39  LGVILGSIPAGLLADRFGRRVIMLISFYGQGAISIAIVYNRSFPVYLILRTMQGFFVQGL 98
           LG  LGS+  G +ADRFGR++ +L++        +       +   L+ R +QG   +G 
Sbjct: 157 LGFFLGSLGVGYIADRFGRKLCLLLTTLINAVSGVLTAVAPDYTSMLLFRLLQGLVSKG- 215

Query: 99  QNSTYTLLIELFPTRWRIGVATYTLLIELFPTRWRIGVAWVTEICWTVGLVMLSLVSYWF 158
                          W  G   YTL+ E   + +R  VA + ++ ++VGLV LS V+Y  
Sbjct: 216 --------------SWMSG---YTLITEFVGSGYRRTVAILYQVAFSVGLVALSGVAYAI 258

Query: 159 PNWRDAELVTSLPFVGFSLFYVWFIPESPLWKYTKNKIIDFEYLCDDESHREASL 213
           PNWR  +L  SLP     LFY W +PESP W  ++ +  D   + D+ + +   L
Sbjct: 259 PNWRWLQLTVSLPTF-LCLFYYWCVPESPRWLLSQKRNTDAVKIMDNIAQKNGKL 312




Translocates a broad array of organic cations with various structures and molecular weights including the model compounds 1-methyl-4-phenylpyridinium (MPP), tetraethylammonium (TEA), N-1-methylnicotinamide (NMN), 4-(4-(dimethylamino)styryl)-N-methylpyridinium (ASP), the endogenous compounds choline, guanidine, histamine, epinephrine, adrenaline, noradrenaline and dopamine, and the drugs quinine, and metformin. The transport of organic cations is inhibited by a broad array of compounds like tetramethylammonium (TMA), cocaine, lidocaine, NMDA receptor antagonists, atropine, prazosin, cimetidine, TEA and NMN, guanidine, cimetidine, choline, procainamide, quinine, tetrabutylammonium, and tetrapentylammonium. Translocates organic cations in an electrogenic and pH-independent manner. Translocates organic cations across the plasma membrane in both directions. Transports the polyamines spermine and spermidine. Transports pramipexole across the basolateral membrane of the proximal tubular epithelial cells. The choline transport is activated by MMTS. Regulated by various intracellular signaling pathways including inhibition by protein kinase A activation, and endogenously activation by the calmodulin complex, the calmodulin-dependent kinase II and LCK tyrosine kinase.
Oryctolagus cuniculus (taxid: 9986)
>sp|A7MBE0|S22A1_BOVIN Solute carrier family 22 member 1 OS=Bos taurus GN=SLC22A1 PE=2 SV=1 Back     alignment and function description
>sp|O57379|S22A6_PSEAM Solute carrier family 22 member 6 OS=Pseudopleuronectes americanus GN=SLC22A6 PE=1 SV=1 Back     alignment and function description
>sp|Q9WTW5|S22A3_MOUSE Solute carrier family 22 member 3 OS=Mus musculus GN=Slc22a3 PE=2 SV=1 Back     alignment and function description
>sp|Q8MJI6|S22A2_RABIT Solute carrier family 22 member 2 OS=Oryctolagus cuniculus GN=SLC22A2 PE=1 SV=1 Back     alignment and function description
>sp|O88446|S22A3_RAT Solute carrier family 22 member 3 OS=Rattus norvegicus GN=Slc22a3 PE=2 SV=1 Back     alignment and function description
>sp|A6QLW8|S22A7_BOVIN Solute carrier family 22 member 7 OS=Bos taurus GN=SLC22A7 PE=2 SV=1 Back     alignment and function description
>sp|O75751|S22A3_HUMAN Solute carrier family 22 member 3 OS=Homo sapiens GN=SLC22A3 PE=1 SV=1 Back     alignment and function description
>sp|O08966|S22A1_MOUSE Solute carrier family 22 member 1 OS=Mus musculus GN=Slc22a1 PE=2 SV=2 Back     alignment and function description
>sp|Q63089|S22A1_RAT Solute carrier family 22 member 1 OS=Rattus norvegicus GN=Slc22a1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query236
350401192 700 PREDICTED: solute carrier family 22 memb 0.716 0.241 0.376 7e-30
340720594 700 PREDICTED: solute carrier family 22 memb 0.622 0.21 0.415 9e-30
380012901 655 PREDICTED: solute carrier family 22 memb 0.720 0.259 0.365 8e-29
328785596 708 PREDICTED: solute carrier family 22 memb 0.665 0.221 0.387 9e-29
307183275 691 Solute carrier family 22 member 8 [Campo 0.601 0.205 0.416 5e-28
322802004 696 hypothetical protein SINV_06783 [Solenop 0.622 0.211 0.385 1e-27
332027943 641 Solute carrier family 22 member 3 [Acrom 0.601 0.221 0.428 1e-27
328785594 731 PREDICTED: solute carrier family 22 memb 0.665 0.214 0.354 4e-25
307205093 744 Solute carrier family 22 member 3 [Harpe 0.622 0.197 0.343 8e-25
383849284 695 PREDICTED: solute carrier family 22 memb 0.694 0.235 0.385 8e-24
>gi|350401192|ref|XP_003486079.1| PREDICTED: solute carrier family 22 member 8-like [Bombus impatiens] Back     alignment and taxonomy information
 Score =  136 bits (343), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 75/199 (37%), Positives = 113/199 (56%), Gaps = 30/199 (15%)

Query: 35  TLYFLGVILGSIPAGLLADRFGRRVIMLISFYGQGAISIAIVYNRSFPVYLILRTMQGFF 94
           T+Y++GV++G+  AGLLADR GR  +  I  Y QG +++A+   +++P +L LR +QG F
Sbjct: 115 TVYYIGVLMGACIAGLLADRIGRLPVQAICLYTQGTMAVALYVVQNYPTFLALRGLQGVF 174

Query: 95  VQGLQNSTYTLLIELFPTRWRIGVATYTLLIELFPTRWRIGVAWVTEICWTVGLVMLSLV 154
           VQGLQNSTY L +ELFP + R    T+              VA V +I W +GL++L+ +
Sbjct: 175 VQGLQNSTYILSLELFPVKAR----TF--------------VALVMQIAWAIGLMLLAAL 216

Query: 155 SYWFPNWRDAELVTSLPFVGFSLFYVWFIPESPLWKYTKNKIIDFEY---------LCDD 205
           SY  P+WR  +L  S+P    ++ Y+W IPESP W   K KI + +          +C  
Sbjct: 217 SYVIPDWRILQLAVSVP-TAITVLYIWIIPESPRWLLAKGKITEADMAVERITKYNVCCT 275

Query: 206 ESHRE--ASLNDYSQGSRP 222
            S RE   +  + S+ + P
Sbjct: 276 RSRRENVKTETNISENATP 294




Source: Bombus impatiens

Species: Bombus impatiens

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|340720594|ref|XP_003398719.1| PREDICTED: solute carrier family 22 member 8-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380012901|ref|XP_003690511.1| PREDICTED: solute carrier family 22 member 8-like [Apis florea] Back     alignment and taxonomy information
>gi|328785596|ref|XP_003250621.1| PREDICTED: solute carrier family 22 member 8-like isoform 2 [Apis mellifera] Back     alignment and taxonomy information
>gi|307183275|gb|EFN70144.1| Solute carrier family 22 member 8 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|322802004|gb|EFZ22541.1| hypothetical protein SINV_06783 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|332027943|gb|EGI67995.1| Solute carrier family 22 member 3 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|328785594|ref|XP_001122149.2| PREDICTED: solute carrier family 22 member 8-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|307205093|gb|EFN83564.1| Solute carrier family 22 member 3 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383849284|ref|XP_003700275.1| PREDICTED: solute carrier family 22 member 8-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query236
UNIPROTKB|Q5T047147 SLC22A7 "Solute carrier family 0.580 0.931 0.282 5e-12
UNIPROTKB|A6NK97 555 SLC22A20 "Solute carrier famil 0.419 0.178 0.292 1.9e-11
ZFIN|ZDB-GENE-091118-62319 slc22a21 "solute carrier famil 0.330 0.244 0.279 2.3e-11
UNIPROTKB|Q2KJE9 557 SLC22A5 "Solute carrier family 0.330 0.140 0.313 7.7e-11
UNIPROTKB|I3L8Z2 484 LOC100627825 "Uncharacterized 0.338 0.165 0.308 9.9e-11
UNIPROTKB|F1SJT6 549 SLC22A13 "Uncharacterized prot 0.338 0.145 0.308 1.4e-10
UNIPROTKB|I3LP03152 I3LP03 "Uncharacterized protei 0.326 0.506 0.397 2.1e-10
UNIPROTKB|E2RPT2 551 SLC22A13 "Uncharacterized prot 0.313 0.134 0.293 4.5e-10
ZFIN|ZDB-GENE-080204-92 554 zgc:175176 "zgc:175176" [Danio 0.512 0.218 0.303 5.9e-10
MGI|MGI:2444335 494 Svopl "SV2 related protein hom 0.364 0.174 0.375 7.7e-10
UNIPROTKB|Q5T047 SLC22A7 "Solute carrier family 22 member 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 162 (62.1 bits), Expect = 5.0e-12, P = 5.0e-12
 Identities = 43/152 (28%), Positives = 77/152 (50%)

Query:    20 WHLYHHECKWNAAVVTLYFLGVILGSIPAGLLADRFGRRVIMLISFYGQGAISIAIVYNR 79
             W L   +   N A  T +F GV++G++  G L+DRFGRR ++L+++     + +A   + 
Sbjct:     3 WDLVCEQKGLNRAASTFFFAGVLVGAVAFGYLSDRFGRRRLLLVAYVSTLVLGLASAASV 62

Query:    80 SFPVYLILRTMQGFFVQGLQNSTYTLLIELFPTRWRIGVATYTLLIELFPTRWRIGVAWV 139
             S+ ++ I RT+ G  + G     +T+++   P    +G A     +E      R     +
Sbjct:    63 SYVMFAITRTLTGSALAG-----FTIIV--MP----LGEAE----LEWLDVEHRTVAGVL 107

Query:   140 TEICWTVGLVMLSLVSYWFPNWRDAELVTSLP 171
             +   WT G+++L+LV Y   +WR   L  +LP
Sbjct:   108 SSTFWTGGVMLLALVGYLIRDWRWLLLAVTLP 139




GO:0016021 "integral to membrane" evidence=IEA
GO:0055085 "transmembrane transport" evidence=IEA
UNIPROTKB|A6NK97 SLC22A20 "Solute carrier family 22 member 20" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-091118-62 slc22a21 "solute carrier family 22 (organic cation transporter), member 21" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KJE9 SLC22A5 "Solute carrier family 22 (Organic cation/carnitine transporter), member 5" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3L8Z2 LOC100627825 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1SJT6 SLC22A13 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LP03 I3LP03 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2RPT2 SLC22A13 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080204-92 zgc:175176 "zgc:175176" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:2444335 Svopl "SV2 related protein homolog (rat)-like" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query236
TIGR00898 505 TIGR00898, 2A0119, cation transport protein 1e-30
cd06174 352 cd06174, MFS, The Major Facilitator Superfamily (M 1e-10
pfam00083 449 pfam00083, Sugar_tr, Sugar (and other) transporter 5e-10
pfam07690 346 pfam07690, MFS_1, Major Facilitator Superfamily 1e-09
TIGR00895 398 TIGR00895, 2A0115, benzoate transport 2e-07
TIGR01299 742 TIGR01299, synapt_SV2, synaptic vesicle protein SV 2e-07
TIGR00895398 TIGR00895, 2A0115, benzoate transport 6e-07
TIGR00880141 TIGR00880, 2_A_01_02, Multidrug resistance protein 2e-06
TIGR00891 405 TIGR00891, 2A0112, putative sialic acid transporte 3e-05
TIGR00879 481 TIGR00879, SP, MFS transporter, sugar porter (SP) 5e-05
TIGR00711 485 TIGR00711, efflux_EmrB, drug resistance transporte 1e-04
TIGR00710 385 TIGR00710, efflux_Bcr_CflA, drug resistance transp 1e-04
TIGR00893 399 TIGR00893, 2A0114, D-galactonate transporter 3e-04
TIGR00881 379 TIGR00881, 2A0104, phosphoglycerate transporter fa 4e-04
PRK11551406 PRK11551, PRK11551, putative 3-hydroxyphenylpropio 4e-04
PRK11551 406 PRK11551, PRK11551, putative 3-hydroxyphenylpropio 5e-04
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (M 9e-04
TIGR00891405 TIGR00891, 2A0112, putative sialic acid transporte 0.001
COG2270438 COG2270, COG2270, Permeases of the major facilitat 0.003
>gnl|CDD|233176 TIGR00898, 2A0119, cation transport protein Back     alignment and domain information
 Score =  117 bits (296), Expect = 1e-30
 Identities = 50/162 (30%), Positives = 84/162 (51%), Gaps = 19/162 (11%)

Query: 35  TLYFLGVILGSIPAGLLADRFGRRVIMLISFYGQGAISIAIVYNRSFPVYLILRTMQGFF 94
           + +F+GV+LGS   G L+DRFGR+ ++L+S        +   ++ ++ V+L+ R + G  
Sbjct: 134 SCFFVGVLLGSFVFGYLSDRFGRKKVLLLSTLVTAVSGVLTAFSPNYTVFLVFRLLVGMG 193

Query: 95  VQGLQNSTYTLLIELFPTRWRIGVATYTLLIELFPTRWRIGVAWVTEICWTVGLVMLSLV 154
           + G                  I V    L  E  P + R  V  + ++ +++GLV+L LV
Sbjct: 194 IGG------------------IWVQAVVLNTEFLPKKQRAIVGTLIQVFFSLGLVLLPLV 235

Query: 155 SYWFPNWRDAELVTSLPFVGFSLFYVWFIPESPLWKYTKNKI 196
           +Y+ P+WR  +L  SLP   F     WF+PESP W  ++ +I
Sbjct: 236 AYFIPDWRWLQLAVSLPTFLF-FLLSWFVPESPRWLISQGRI 276


[Transport and binding proteins, Cations and iron carrying compounds]. Length = 505

>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|215702 pfam00083, Sugar_tr, Sugar (and other) transporter Back     alignment and domain information
>gnl|CDD|219516 pfam07690, MFS_1, Major Facilitator Superfamily Back     alignment and domain information
>gnl|CDD|233175 TIGR00895, 2A0115, benzoate transport Back     alignment and domain information
>gnl|CDD|130366 TIGR01299, synapt_SV2, synaptic vesicle protein SV2 Back     alignment and domain information
>gnl|CDD|233175 TIGR00895, 2A0115, benzoate transport Back     alignment and domain information
>gnl|CDD|233166 TIGR00880, 2_A_01_02, Multidrug resistance protein Back     alignment and domain information
>gnl|CDD|233172 TIGR00891, 2A0112, putative sialic acid transporter Back     alignment and domain information
>gnl|CDD|233165 TIGR00879, SP, MFS transporter, sugar porter (SP) family Back     alignment and domain information
>gnl|CDD|129794 TIGR00711, efflux_EmrB, drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>gnl|CDD|233099 TIGR00710, efflux_Bcr_CflA, drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>gnl|CDD|233174 TIGR00893, 2A0114, D-galactonate transporter Back     alignment and domain information
>gnl|CDD|233167 TIGR00881, 2A0104, phosphoglycerate transporter family protein Back     alignment and domain information
>gnl|CDD|236927 PRK11551, PRK11551, putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>gnl|CDD|236927 PRK11551, PRK11551, putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|233172 TIGR00891, 2A0112, putative sialic acid transporter Back     alignment and domain information
>gnl|CDD|225179 COG2270, COG2270, Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 236
TIGR00898 505 2A0119 cation transport protein. 99.9
KOG0255|consensus 521 99.89
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.87
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 99.85
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 99.84
KOG0569|consensus 485 99.84
PRK10077 479 xylE D-xylose transporter XylE; Provisional 99.84
KOG0254|consensus 513 99.82
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 99.82
TIGR00891 405 2A0112 putative sialic acid transporter. 99.8
PRK15403 413 multidrug efflux system protein MdtM; Provisional 99.79
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.79
PRK10642 490 proline/glycine betaine transporter; Provisional 99.78
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 99.78
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 99.77
TIGR00893 399 2A0114 d-galactonate transporter. 99.77
PRK03545 390 putative arabinose transporter; Provisional 99.77
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 99.77
PRK10406 432 alpha-ketoglutarate transporter; Provisional 99.76
PRK14995 495 methyl viologen resistance protein SmvA; Provision 99.76
TIGR00895 398 2A0115 benzoate transport. 99.76
PRK11663 434 regulatory protein UhpC; Provisional 99.76
PRK10213 394 nepI ribonucleoside transporter; Reviewed 99.76
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.75
KOG1330|consensus 493 99.74
PRK12307 426 putative sialic acid transporter; Provisional 99.74
PRK10091 382 MFS transport protein AraJ; Provisional 99.74
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.74
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 99.73
PRK09952 438 shikimate transporter; Provisional 99.73
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 99.73
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 99.73
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.73
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 99.72
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.72
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 99.72
PRK10473 392 multidrug efflux system protein MdtL; Provisional 99.71
TIGR00900 365 2A0121 H+ Antiporter protein. 99.71
KOG2533|consensus 495 99.71
PRK03893 496 putative sialic acid transporter; Provisional 99.71
PRK09705 393 cynX putative cyanate transporter; Provisional 99.71
PRK11652 394 emrD multidrug resistance protein D; Provisional 99.7
KOG2532|consensus 466 99.7
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 99.7
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 99.69
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 99.68
PRK11043 401 putative transporter; Provisional 99.67
PLN00028 476 nitrate transmembrane transporter; Provisional 99.67
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.67
PRK12382 392 putative transporter; Provisional 99.66
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 99.66
PRK11646 400 multidrug resistance protein MdtH; Provisional 99.66
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 99.66
PRK11195 393 lysophospholipid transporter LplT; Provisional 99.66
KOG2615|consensus 451 99.65
KOG0253|consensus 528 99.65
PRK10054 395 putative transporter; Provisional 99.65
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 99.65
PRK03699 394 putative transporter; Provisional 99.65
PRK15075 434 citrate-proton symporter; Provisional 99.64
PRK05122 399 major facilitator superfamily transporter; Provisi 99.64
PRK10504 471 putative transporter; Provisional 99.64
PRK10642490 proline/glycine betaine transporter; Provisional 99.63
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 99.63
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 99.62
PTZ00207 591 hypothetical protein; Provisional 99.61
TIGR00880141 2_A_01_02 Multidrug resistance protein. 99.61
PRK10133 438 L-fucose transporter; Provisional 99.61
PRK09874 408 drug efflux system protein MdtG; Provisional 99.61
TIGR00892 455 2A0113 monocarboxylate transporter 1. 99.59
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 99.59
PRK10207 489 dipeptide/tripeptide permease B; Provisional 99.57
KOG0252|consensus 538 99.57
PRK03633 381 putative MFS family transporter protein; Provision 99.56
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.56
TIGR00897 402 2A0118 polyol permease family. This family of prot 99.55
PRK10489 417 enterobactin exporter EntS; Provisional 99.55
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 99.55
KOG3764|consensus 464 99.54
TIGR00805 633 oat sodium-independent organic anion transporter. 99.53
TIGR00896 355 CynX cyanate transporter. This family of proteins 99.53
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.51
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.49
TIGR00901 356 2A0125 AmpG-related permease. 99.48
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 99.48
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.44
PRK15011 393 sugar efflux transporter B; Provisional 99.43
PRK11902 402 ampG muropeptide transporter; Reviewed 99.41
TIGR00889418 2A0110 nucleoside transporter. This family of prot 99.39
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 99.38
PRK15462 493 dipeptide/tripeptide permease D; Provisional 99.37
PRK15011393 sugar efflux transporter B; Provisional 99.37
PRK09584 500 tppB putative tripeptide transporter permease; Rev 99.37
PRK09528420 lacY galactoside permease; Reviewed 99.35
PRK11010 491 ampG muropeptide transporter; Validated 99.35
PRK05122399 major facilitator superfamily transporter; Provisi 99.32
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 99.31
PRK10077479 xylE D-xylose transporter XylE; Provisional 99.31
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 99.3
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 99.3
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 99.28
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 99.27
PRK03893496 putative sialic acid transporter; Provisional 99.26
KOG0569|consensus485 99.26
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 99.26
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 99.25
PRK10489417 enterobactin exporter EntS; Provisional 99.25
PRK09874408 drug efflux system protein MdtG; Provisional 99.25
PRK12382392 putative transporter; Provisional 99.24
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 99.23
PRK09528 420 lacY galactoside permease; Reviewed 99.23
TIGR00892455 2A0113 monocarboxylate transporter 1. 99.22
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 99.22
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 99.21
PRK09952438 shikimate transporter; Provisional 99.21
TIGR00898505 2A0119 cation transport protein. 99.2
KOG2504|consensus 509 99.19
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 99.18
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 99.16
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 99.16
TIGR00889 418 2A0110 nucleoside transporter. This family of prot 99.15
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 99.15
PRK03699394 putative transporter; Provisional 99.13
PRK09705393 cynX putative cyanate transporter; Provisional 99.13
PRK03545390 putative arabinose transporter; Provisional 99.11
PRK03633381 putative MFS family transporter protein; Provision 99.09
TIGR00902382 2A0127 phenyl proprionate permease family protein. 99.08
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 99.07
TIGR00893399 2A0114 d-galactonate transporter. 99.05
TIGR00891405 2A0112 putative sialic acid transporter. 99.05
PLN00028476 nitrate transmembrane transporter; Provisional 99.05
PF05631354 DUF791: Protein of unknown function (DUF791); Inte 99.03
COG2270438 Permeases of the major facilitator superfamily [Ge 99.02
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 99.02
KOG0253|consensus528 99.01
PRK10504471 putative transporter; Provisional 99.0
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 98.99
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 98.98
PRK12307426 putative sialic acid transporter; Provisional 98.97
TIGR00897402 2A0118 polyol permease family. This family of prot 98.97
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 98.97
TIGR00900365 2A0121 H+ Antiporter protein. 98.96
PRK10406432 alpha-ketoglutarate transporter; Provisional 98.96
TIGR00895398 2A0115 benzoate transport. 98.95
PRK11010491 ampG muropeptide transporter; Validated 98.95
PRK15075434 citrate-proton symporter; Provisional 98.95
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 98.94
KOG0254|consensus513 98.92
PF05977524 MFS_3: Transmembrane secretion effector; InterPro: 98.92
PRK09848448 glucuronide transporter; Provisional 98.9
PRK09669 444 putative symporter YagG; Provisional 98.88
PRK11663434 regulatory protein UhpC; Provisional 98.88
PRK10429473 melibiose:sodium symporter; Provisional 98.88
COG2807 395 CynX Cyanate permease [Inorganic ion transport and 98.84
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 98.84
PRK15402406 multidrug efflux system translocase MdfA; Provisio 98.83
TIGR00788 468 fbt folate/biopterin transporter. The only functio 98.82
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 98.81
TIGR02718 390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 98.8
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 98.79
KOG2325|consensus 488 98.79
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 98.78
PRK09669444 putative symporter YagG; Provisional 98.77
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 98.77
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 98.76
PRK10054395 putative transporter; Provisional 98.76
PRK10091382 MFS transport protein AraJ; Provisional 98.75
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 98.75
PRK10473392 multidrug efflux system protein MdtL; Provisional 98.73
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 98.72
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 98.71
PRK14995495 methyl viologen resistance protein SmvA; Provision 98.71
PRK10429 473 melibiose:sodium symporter; Provisional 98.7
PF13347 428 MFS_2: MFS/sugar transport protein 98.7
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 98.7
PRK10213394 nepI ribonucleoside transporter; Reviewed 98.67
PRK11902402 ampG muropeptide transporter; Reviewed 98.67
TIGR01272310 gluP glucose/galactose transporter. Disruption of 98.66
TIGR00901356 2A0125 AmpG-related permease. 98.66
PRK11195393 lysophospholipid transporter LplT; Provisional 98.66
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 98.65
COG0477338 ProP Permeases of the major facilitator superfamil 98.64
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 98.63
PRK11646400 multidrug resistance protein MdtH; Provisional 98.63
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 98.61
PRK10133438 L-fucose transporter; Provisional 98.6
KOG2504|consensus509 98.6
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 98.59
COG2211467 MelB Na+/melibiose symporter and related transport 98.58
TIGR00896355 CynX cyanate transporter. This family of proteins 98.56
TIGR00881379 2A0104 phosphoglycerate transporter family protein 98.56
PRK11462460 putative transporter; Provisional 98.56
PRK09584500 tppB putative tripeptide transporter permease; Rev 98.56
PF13347428 MFS_2: MFS/sugar transport protein 98.54
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 98.54
KOG2816|consensus 463 98.52
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 98.52
PRK11462 460 putative transporter; Provisional 98.51
KOG0252|consensus538 98.51
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 98.49
TIGR00788468 fbt folate/biopterin transporter. The only functio 98.48
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 98.44
KOG4686|consensus459 98.43
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 98.43
PF03825 400 Nuc_H_symport: Nucleoside H+ symporter 98.43
PRK11043401 putative transporter; Provisional 98.4
PRK09848 448 glucuronide transporter; Provisional 98.4
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 98.36
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 98.36
PRK10207489 dipeptide/tripeptide permease B; Provisional 98.34
KOG0255|consensus521 98.33
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 98.31
PF11700 477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 98.3
PRK11652394 emrD multidrug resistance protein D; Provisional 98.28
KOG2563|consensus 480 98.23
COG2807395 CynX Cyanate permease [Inorganic ion transport and 98.22
KOG3762|consensus618 98.2
PF01306 412 LacY_symp: LacY proton/sugar symporter; InterPro: 98.18
PF03137 539 OATP: Organic Anion Transporter Polypeptide (OATP) 98.14
PF05978156 UNC-93: Ion channel regulatory protein UNC-93; Int 98.13
PF01770 412 Folate_carrier: Reduced folate carrier; InterPro: 98.11
COG2211 467 MelB Na+/melibiose symporter and related transport 98.08
TIGR01301477 GPH_sucrose GPH family sucrose/H+ symporter. This 98.07
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 98.06
TIGR01272 310 gluP glucose/galactose transporter. Disruption of 97.91
KOG3764|consensus464 97.81
PTZ00207591 hypothetical protein; Provisional 97.8
PF03209 403 PUCC: PUCC protein; InterPro: IPR004896 This prote 97.78
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 97.73
PRK15403413 multidrug efflux system protein MdtM; Provisional 97.69
PF06609599 TRI12: Fungal trichothecene efflux pump (TRI12); I 97.67
PF0677985 DUF1228: Protein of unknown function (DUF1228); In 97.63
PF03092 433 BT1: BT1 family; InterPro: IPR004324 Members of th 97.62
KOG2532|consensus466 97.59
KOG2533|consensus495 97.57
COG0738422 FucP Fucose permease [Carbohydrate transport and m 97.55
PRK15462493 dipeptide/tripeptide permease D; Provisional 97.46
KOG3626|consensus 735 97.43
KOG4686|consensus 459 97.26
PF1283277 MFS_1_like: MFS_1 like family 97.25
PF00854 372 PTR2: POT family; InterPro: IPR000109 This entry r 97.09
COG2270 438 Permeases of the major facilitator superfamily [Ge 97.07
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 97.06
KOG4332|consensus 454 97.03
KOG2816|consensus463 96.95
PF02487 402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 96.95
TIGR00769 472 AAA ADP/ATP carrier protein family. These proteins 96.91
KOG3098|consensus461 96.81
KOG2615|consensus451 96.36
COG3104498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 96.29
PRK03612 521 spermidine synthase; Provisional 96.26
PF02487402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 95.98
KOG1237|consensus 571 95.98
KOG0637|consensus 498 95.87
KOG3098|consensus 461 95.21
PF03219 491 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 93.91
PF06963432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 93.69
KOG2563|consensus480 93.16
COG3202 509 ATP/ADP translocase [Energy production and convers 92.87
KOG3762|consensus 618 92.73
TIGR00939 437 2a57 Equilibrative Nucleoside Transporter (ENT). 92.48
KOG1330|consensus493 91.32
KOG3574|consensus 510 90.01
KOG0637|consensus498 89.52
PF06963 432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 88.44
TIGR00806511 rfc RFC reduced folate carrier. Proteins of the RF 87.55
KOG3810|consensus 433 86.85
TIGR00939437 2a57 Equilibrative Nucleoside Transporter (ENT). 83.81
KOG1479|consensus 406 83.12
PF01770412 Folate_carrier: Reduced folate carrier; InterPro: 82.76
KOG1479|consensus406 82.5
TIGR01666 704 YCCS hypothetical membrane protein, TIGR01666. Thi 82.33
TIGR00805633 oat sodium-independent organic anion transporter. 81.06
KOG3880|consensus409 81.01
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
Probab=99.90  E-value=1.6e-22  Score=182.44  Aligned_cols=174  Identities=29%  Similarity=0.570  Sum_probs=157.8

Q ss_pred             CcceeeeeeeecCcchhHHHHHHHHHHHHhhhhhhhhhhhhhCchHHHHHHHHHHHHHHHHHHHhccHHHHHHHHHHHHH
Q psy12153         14 GEPVLLWHLYHHECKWNAAVVTLYFLGVILGSIPAGLLADRFGRRVIMLISFYGQGAISIAIVYNRSFPVYLILRTMQGF   93 (236)
Q Consensus        14 ~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~g~l~Dr~Grr~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~g~   93 (236)
                      .++.+||++.|++..+.++..+++.++..+++++.|+++||+|||++++++.++..++.++.+++++++.+++.|++.|+
T Consensus       113 ~~i~~e~~l~c~~~~~~~~~~s~~~~g~~~g~~~~g~l~Dr~Grr~~~~~~~~~~~i~~~~~~~~~~~~~~~~~r~l~G~  192 (505)
T TIGR00898       113 STIVTEWDLVCEDAWKVDLTQSCFFVGVLLGSFVFGYLSDRFGRKKVLLLSTLVTAVSGVLTAFSPNYTVFLVFRLLVGM  192 (505)
T ss_pred             ccEEEEecceechHHHHHHHHHHHHHHHHHHHHhHHHhhhhccchHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHh
Confidence            46789999988889999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhhhHHHHHHHHhhcCccccccccchhhhhhccccccchhhHHHHHHHHHHHHHHHHHHHHhcchhHHHHHHHHhHHH
Q psy12153         94 FVQGLQNSTYTLLIELFPTRWRIGVATYTLLIELFPTRWRIGVAWVTEICWTVGLVMLSLVSYWFPNWRDAELVTSLPFV  173 (236)
Q Consensus        94 ~~~~~~~~~~~~~~e~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~l~~~i~~~~~~w~~~~~i~~~~~~  173 (236)
                      +.+...+....++.|++|+++|                  +...++...+..+|.++++.++..+.+||+.+++.+++. 
T Consensus       193 ~~~~~~~~~~~~~~e~~~~~~r------------------~~~~~~~~~~~~~g~~~~~~~~~~~~~wr~~~~~~~i~~-  253 (505)
T TIGR00898       193 GIGGIWVQAVVLNTEFLPKKQR------------------AIVGTLIQVFFSLGLVLLPLVAYFIPDWRWLQLAVSLPT-  253 (505)
T ss_pred             hccchHHHHHHHhheecChhhh------------------HHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHH-
Confidence            9999999999999999999999                  999999999999999999999988888999999998887 


Q ss_pred             HHHHHHHhhcccchhHHHhcCCHhHHHHHHHHh
Q psy12153        174 GFSLFYVWFIPESPLWKYTKNKIIDFEYLCDDE  206 (236)
Q Consensus       174 ~~~~~~~~~~pet~~~~~~~~~~~~~~~~~~~~  206 (236)
                      ++..+..+++||+|+|...+++.+++.+..++.
T Consensus       254 ~~~~~~~~~~~esp~~l~~~~~~~~a~~~l~~~  286 (505)
T TIGR00898       254 FLFFLLSWFVPESPRWLISQGRIEEALKILQRI  286 (505)
T ss_pred             HHHHHHHHhcCCChHHHHHCCCHHHHHHHHHHH
Confidence            444455578999999998888877776655543



>KOG0255|consensus Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>KOG2325|consensus Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>COG0477 ProP Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>KOG2563|consensus Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>PF05978 UNC-93: Ion channel regulatory protein UNC-93; InterPro: IPR010291 The proteins in this family are represented by UNC-93 from Caenorhabditis elegans Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PF06779 DUF1228: Protein of unknown function (DUF1228); InterPro: IPR010645 This entry represents the N terminus of several putative bacterial membrane proteins, which may be sugar transporters Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>KOG3626|consensus Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>PF12832 MFS_1_like: MFS_1 like family Back     alignment and domain information
>PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>KOG4332|consensus Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>KOG3098|consensus Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>KOG1237|consensus Back     alignment and domain information
>KOG0637|consensus Back     alignment and domain information
>KOG3098|consensus Back     alignment and domain information
>PF03219 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 These proteins are members of the ATP:ADP Antiporter (AAA) family, which consists of nucleotide transporters that have 12 GES predicted transmembrane regions Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>KOG2563|consensus Back     alignment and domain information
>COG3202 ATP/ADP translocase [Energy production and conversion] Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>TIGR00939 2a57 Equilibrative Nucleoside Transporter (ENT) Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>KOG3574|consensus Back     alignment and domain information
>KOG0637|consensus Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>KOG3810|consensus Back     alignment and domain information
>TIGR00939 2a57 Equilibrative Nucleoside Transporter (ENT) Back     alignment and domain information
>KOG1479|consensus Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>KOG1479|consensus Back     alignment and domain information
>TIGR01666 YCCS hypothetical membrane protein, TIGR01666 Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>KOG3880|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query236
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 9e-06
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 2e-05
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 5e-05
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Length = 375 Back     alignment and structure
 Score = 44.9 bits (107), Expect = 9e-06
 Identities = 16/61 (26%), Positives = 27/61 (44%)

Query: 33  VVTLYFLGVILGSIPAGLLADRFGRRVIMLISFYGQGAISIAIVYNRSFPVYLILRTMQG 92
           V+  Y L   +  +  G ++DR GRR ++L+        ++  V   S  V +    MQG
Sbjct: 40  VMGAYLLTYGVSQLFYGPISDRVGRRPVILVGMSIFMLATLVAVTTSSLTVLIAASAMQG 99

Query: 93  F 93
            
Sbjct: 100 M 100


>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Length = 451 Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Length = 451 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query236
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 99.88
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 99.79
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 99.78
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 99.77
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 99.73
2xut_A 524 Proton/peptide symporter family protein; transport 99.65
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 99.51
2cfq_A417 Lactose permease; transport, transport mechanism, 99.33
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 99.31
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 99.17
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 99.12
2cfq_A 417 Lactose permease; transport, transport mechanism, 99.11
2xut_A524 Proton/peptide symporter family protein; transport 98.63
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 98.31
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
Probab=99.88  E-value=2.1e-22  Score=178.51  Aligned_cols=163  Identities=21%  Similarity=0.291  Sum_probs=142.5

Q ss_pred             CcchhHHHHHHHHHHHHhhhhhhhhhhhhhCchHHHHHHHHHHHHHHHHHH------------------HhccHHHHHHH
Q psy12153         26 ECKWNAAVVTLYFLGVILGSIPAGLLADRFGRRVIMLISFYGQGAISIAIV------------------YNRSFPVYLIL   87 (236)
Q Consensus        26 ~~~~~~~~~~~~~l~~~~~~~~~g~l~Dr~Grr~~l~~~~~~~~~~~~~~~------------------~~~~~~~~~~~   87 (236)
                      +..+.+++.+.+.+|..+|++++|+++||+|||++++++.++..++.++++                  .++|++.++++
T Consensus        53 ~~~~~g~~~s~~~~G~~iG~~~~G~laDr~GRk~~l~~~~~l~~i~~i~~a~~~~~~~~~~~~~~~~~~~a~~~~~l~~~  132 (491)
T 4gc0_A           53 ANSLLGFCVASALIGCIIGGALGGYCSNRFGRRDSLKIAAVLFFISGVGSAWPELGFTSINPDNTVPVYLAGYVPEFVIY  132 (491)
T ss_dssp             HHHHHHHHHHTHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHHHHHHCTTTTTSCSSSSSSCCGGGGGCHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHHHHHHhhhhhhhcchhHHHHHHhhhHHHHHHH
Confidence            456678999999999999999999999999999999999999999999888                  47899999999


Q ss_pred             HHHHHHhhhhhhHHHHHHHHhhcCccccccccchhhhhhccccccchhhHHHHHHHHHHHHHHHHHHHHhcc--------
Q psy12153         88 RTMQGFFVQGLQNSTYTLLIELFPTRWRIGVATYTLLIELFPTRWRIGVAWVTEICWTVGLVMLSLVSYWFP--------  159 (236)
Q Consensus        88 ~~l~g~~~~~~~~~~~~~~~e~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~l~~~i~~~~~--------  159 (236)
                      |+++|++.|+..+....+++|+.|+++|                  ++..+..+.+..+|.++++.++....        
T Consensus       133 R~l~G~g~G~~~~~~~~~i~E~~p~~~r------------------g~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~  194 (491)
T 4gc0_A          133 RIIGGIGVGLASMLSPMYIAELAPAHIR------------------GKLVSFNQFAIIFGQLLVYCVNYFIARSGDASWL  194 (491)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTTSCGGGH------------------HHHHHHHHHHHHHHHHHHHHHHHHHHTTSCTTTT
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhCCHHhh------------------hhhHHhhhhhhhhhhhhhhhcchhhccccccccc
Confidence            9999999999999999999999999999                  99999999999999999888776542        


Q ss_pred             ---hhHHHHHHHHhHHHHHHHHHHhhcccchhHHHhcCCHhHHHHHHHHhh
Q psy12153        160 ---NWRDAELVTSLPFVGFSLFYVWFIPESPLWKYTKNKIIDFEYLCDDES  207 (236)
Q Consensus       160 ---~w~~~~~i~~~~~~~~~~~~~~~~pet~~~~~~~~~~~~~~~~~~~~~  207 (236)
                         .||..+.+..+.. +..++..+++||||+|...+++.+++.+.+++..
T Consensus       195 ~~~~~~~~~~~~~~~~-~~~~~~~~~~peSp~~L~~~~~~~~a~~~l~~~~  244 (491)
T 4gc0_A          195 NTDGWRYMFASECIPA-LLFLMLLYTVPESPRWLMSRGKQEQAEGILRKIM  244 (491)
T ss_dssp             TTTHHHHHHHTTHHHH-HHHHHHGGGSCCCHHHHHHTTCHHHHHHHHHHHH
T ss_pred             cchhhHHHhhhhhhhh-hhhhhhhhcCCCChHHHHHcCchhHHHHhHHHhc
Confidence               4676766666665 6667778889999999999999888777665543



>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 236
d1pw4a_ 447 f.38.1.1 (A:) Glycerol-3-phosphate transporter {Es 1e-06
d1pv7a_ 417 f.38.1.2 (A:) Lactose permease {Escherichia coli [ 4e-04
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Length = 447 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
 Score = 46.2 bits (108), Expect = 1e-06
 Identities = 16/146 (10%), Positives = 40/146 (27%), Gaps = 15/146 (10%)

Query: 33  VVTLYFLGVILGSIPAGLLADRFGRRVIMLISFYGQGAISIAIV----YNRSFPVYLILR 88
            ++   +         G ++DR   RV +        A+ + +        S  V  +L 
Sbjct: 64  ALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAAAVMLFMGFVPWATSSIAVMFVLL 123

Query: 89  TMQGFFVQGLQNSTYTLLIELFPTRWRIGVATYTL-----------LIELFPTRWRIGVA 137
            + G+F           ++  +  + R G+ +              L+ L    W     
Sbjct: 124 FLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGMAWFNDWH 183

Query: 138 WVTEICWTVGLVMLSLVSYWFPNWRD 163
               +     +++         +   
Sbjct: 184 AALYMPAFCAILVALFAFAMMRDTPQ 209


>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Length = 417 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query236
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 99.79
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 99.43
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 99.29
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 99.14
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=99.79  E-value=7.3e-20  Score=157.08  Aligned_cols=151  Identities=15%  Similarity=0.129  Sum_probs=134.4

Q ss_pred             eeeeeeecCcchhHHHHHHHHHHHHhhhhhhhhhhhhhCchHHHHHHHHHHHHHHHHHHHh----ccHHHHHHHHHHHHH
Q psy12153         18 LLWHLYHHECKWNAAVVTLYFLGVILGSIPAGLLADRFGRRVIMLISFYGQGAISIAIVYN----RSFPVYLILRTMQGF   93 (236)
Q Consensus        18 ~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~g~l~Dr~Grr~~l~~~~~~~~~~~~~~~~~----~~~~~~~~~~~l~g~   93 (236)
                      +|+++   +..+.+++.+++.++..++++++|+++||+|||+++.++.++.+++.++.+..    ++++.+++.|++.|+
T Consensus        52 ~~~g~---s~~~~g~~~s~~~~~~~~~~~~~G~l~Dr~g~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~  128 (447)
T d1pw4a_          52 VEQGF---SRGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAAAVMLFMGFVPWATSSIAVMFVLLFLCGW  128 (447)
T ss_dssp             TSSTT---CSSCHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHCHHHHSSSSHHHHHHHHHHH
T ss_pred             HHhCc---CHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCchHHHHHHHHHHHHHHhhccccchhhhhHHHHHHHHHHHHH
Confidence            46788   99999999999999999999999999999999999999999999988888764    477889999999999


Q ss_pred             hhhhhhHHHHHHHHhhcCccccccccchhhhhhccccccchhhHHHHHHHHHHHHHHHHHHHHhc----chhHHHHHHHH
Q psy12153         94 FVQGLQNSTYTLLIELFPTRWRIGVATYTLLIELFPTRWRIGVAWVTEICWTVGLVMLSLVSYWF----PNWRDAELVTS  169 (236)
Q Consensus        94 ~~~~~~~~~~~~~~e~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~l~~~i~~~~----~~w~~~~~i~~  169 (236)
                      +.+...+....++.|++|+++|                  ++..++.+.+..+|..+++.+....    .+||+.+++.+
T Consensus       129 ~~~~~~~~~~~~i~~~~~~~~r------------------~~~~~~~~~~~~~g~~i~~~~~~~~~~~~~~w~~~~~~~~  190 (447)
T d1pw4a_         129 FQGMGWPPCGRTMVHWWSQKER------------------GGIVSVWNCAHNVGGGIPPLLFLLGMAWFNDWHAALYMPA  190 (447)
T ss_dssp             HHHHTHHHHHHHHHTTCTTTHH------------------HHHHHHHHHHHHHHHTSHHHHHHHHHHHTCCSTTCTHHHH
T ss_pred             hhhhhhhHHHHHHHHHHHhhcc------------------cccccccccccchhhhhhhhhhhhHhhhhhcccccchhhh
Confidence            9999999999999999999999                  9999999999999999888776654    37999999888


Q ss_pred             hHHHHHHHHHHhhcccchhH
Q psy12153        170 LPFVGFSLFYVWFIPESPLW  189 (236)
Q Consensus       170 ~~~~~~~~~~~~~~pet~~~  189 (236)
                      ++.++..++.+++.+|+|+.
T Consensus       191 ~~~~~~~~~~~~~~~~~~~~  210 (447)
T d1pw4a_         191 FCAILVALFAFAMMRDTPQS  210 (447)
T ss_dssp             HHHHHHHHHHHHHCCCSSTT
T ss_pred             hhHHHHHHHHHHhcccchhh
Confidence            88877777788888887654



>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure