Diaphorina citri psyllid: psy12154


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210----
MSPGSFCDLKFRPVVEVVDDFRSISLTLTASHFKSAADLGTLGRVEMLPISWHEALHSEESGIDKKLKAITLPSIPKLRYFTNDTLLDVLFYTSPVYCERIITAVAKEMNRLYAIFLARNPTYEGGVSVGGHSLGSLILFDLLSHQKPVGGLNSDDVKDSDTDDETLGKSPLLKGNSYISIPTATLGTSAPLIRYHQLSFQPRMFFAFGSPVGV
cccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEECcccccc
***GSFCDLKFRPVVEVVDDFRSISLTLTASHFKSAADLGTLGRVEMLPISWHEALHSEESGIDKKLKAITLPSIPKLRYFTNDTLLDVLFYTSPVYCERIITAVAKEMNRLYAIFLARNPTYEGGVSVGGHSLGSLILFDLLSHQ***************************KG*S**S*******TSAPLIRYHQLSFQPRMFFAFGSPVGV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSPGSFCDLKFRPVVEVVDDFRSISLTLTASHFKSAADLGTLGRVEMLPISWHEALHSEESGIDKKLKAITLPSIPKLRYFTNDTLLDVLFYTSPVYCERIITAVAKEMNRLYAIFLARNPTYEGGVSVGGHSLGSLILFDLLSHQKPVGGLNSDDVKDSDTDDETLGKSPLLKGNSYISIPTATLGTSAPLIRYHQLSFQPRMFFAFGSPVGV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phospholipase DDHD2 Phospholipase that hydrolyzes preferentially phosphatidic acid and phosphatidylethanolamine. May be involved in the maintenance of the endoplasmic reticulum and/or Golgi structures.confidentQ80Y98
Phospholipase DDHD2 Phospholipase that hydrolyzes preferentially phosphatidic acid and phosphatidylethanolamine. May be involved in the maintenance of the endoplasmic reticulum and/or Golgi structures.confidentO94830

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1BU8, chain A
Confidence level:probable
Coverage over the Query: 103-149
View the alignment between query and template
View the model in PyMOL