Diaphorina citri psyllid: psy12154

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210----

MSPGSFCDLKFRPVVEVVDDFRSISLTLTASHFKSAADLGTLGRVEMLPISWHEALHSEESGIDKKLKAITLPSIPKLRYFTNDTLLDVLFYTSPVYCERIITAVAKEMNRLYAIFLARNPTYEGGVSVGGHSLGSLILFDLLSHQKPVGGLNSDDVKDSDTDDETLGKSPLLKGNSYISIPTATLGTSAPLIRYHQLSFQPRMFFAFGSPVGV

cccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEECcccccc

***GSFCDLKFRPVVEVVDDFRSISLTLTASHFKSAADLGTLGRVEMLPISWHEALHSEESGIDKKLKAITLPSIPKLRYFTNDTLLDVLFYTSPVYCERIITAVAKEMNRLYAIFLARNPTYEGGVSVGGHSLGSLILFDLLSHQ***************************KG*S**S*******TSAPLIRYHQLSFQPRMFFAFGSPVGV

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Phospholipase DDHD2	Phospholipase that hydrolyzes preferentially phosphatidic acid and phosphatidylethanolamine. May be involved in the maintenance of the endoplasmic reticulum and/or Golgi structures.	confident	Q80Y98
Phospholipase DDHD2	Phospholipase that hydrolyzes preferentially phosphatidic acid and phosphatidylethanolamine. May be involved in the maintenance of the endoplasmic reticulum and/or Golgi structures.	confident	O94830

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0043231 [CC]	intracellular membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005813 [CC]	centrosome	probable	GO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1BU8, chain A
Confidence level:probable
Coverage over the Query: 103-149
View the alignment between query and template
View the model in PyMOL