Psyllid ID: psy12154

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210----
MSPGSFCDLKFRPVVEVVDDFRSISLTLTASHFKSAADLGTLGRVEMLPISWHEALHSEESGIDKKLKAITLPSIPKLRYFTNDTLLDVLFYTSPVYCERIITAVAKEMNRLYAIFLARNPTYEGGVSVGGHSLGSLILFDLLSHQKPVGGLNSDDVKDSDTDDETLGKSPLLKGNSYISIPTATLGTSAPLIRYHQLSFQPRMFFAFGSPVGV
cccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccc
ccccccccccHccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEccccccccccccHHHHHcccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHccccccccccccccccccccHHHccccccccHHHHHccccHcccccccccccccccEcccHEEEccccccc
mspgsfcdlkfrpvvevVDDFRSISLTLTashfksaadlgtlgrvemlPISWHEALHSEESGIDKKlkaitlpsipklryftndtlLDVLFYTSPVYCERIITAVAKEMNRLYAIFLarnptyeggvsvgghslGSLILFDLlshqkpvgglnsddvkdsdtddetlgkspllkgnsyisiptatlgtsapliryhqlsfqprmffafgspvgv
mspgsfcdlkfrpVVEVVDDFRSISLTltashfksaadlgtLGRVEMLPISWHEALHSEESGIDKKLKAITLPSIPKLRYFTNDTLLDVLFYTSPVYCERIITAVAKEMNRLYAIFLARNPTYEGGVSVGGHSLGSLILFDLLSHQKPVGglnsddvkdsdtddetlgkspllkgnsyisIPTATLGTSAPLIRYHQLSFQPRMFFAFGSPVGV
MSPGSFCDLKFRPVVEVVDDFRSISLTLTASHFKSAADLGTLGRVEMLPISWHEALHSEESGIDKKLKAITLPSIPKLRYFTNDTLLDVLFYTSPVYCERIITAVAKEMNRLYAIFLARNPTYEggvsvgghslgslILFDLLSHQKPVGGLNSddvkdsdtddETLGKSPLLKGNSYISIPTATLGTSAPLIRYHQLSFQPRMFFAFGSPVGV
*****FCDLKFRPVVEVVDDFRSISLTLTASHFKSAADLGTLGRVEMLPISWHEALHSEESGIDKKLKAITLPSIPKLRYFTNDTLLDVLFYTSPVYCERIITAVAKEMNRLYAIFLARNPTYEGGVSVGGHSLGSLILFDLLSH****************************KGNSYISIPTATLGTSAPLIRYHQLSFQPRMFFAFG*****
***GSFCDLKFRPVVEVVDDFRSISLTLTASHFKSAADLGTLGRVEMLPISWHEALHSEESGIDKKLKAITLPSIPKLRYFTNDTLLDVLFYTSPVYCERIITAVAKEMNRLYAIFLARNPTYEGGVSVGGHSLGSLILFDLLSHQ**************************************************QLSFQPRMFFAFGSPVGV
MSPGSFCDLKFRPVVEVVDDFRSISLTLTASHFKSAADLGTLGRVEMLPISWHEALHSEESGIDKKLKAITLPSIPKLRYFTNDTLLDVLFYTSPVYCERIITAVAKEMNRLYAIFLARNPTYEGGVSVGGHSLGSLILFDLLSHQKPVGGLNSDD**********LGKSPLLKGNSYISIPTATLGTSAPLIRYHQLSFQPRMFFAFGSPVGV
****SFCDLKFRPVVEVVDDFRSISLTLTASHFKSAADLGTLGRVEMLPISWHEALHSEESGIDKKLKAITLPSIPKLRYFTNDTLLDVLFYTSPVYCERIITAVAKEMNRLYAIFLARNPTYEGGVSVGGHSLGSLILFDLLSHQKPV*********************P*LKG*S**S*******TSAPLIRYHQLSFQPRMFFAFGSPVG*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSPGSFCDLKFRPVVEVVDDFRSISLTLTASHFKSAADLGTLGRVEMLPISWHEALHSEESGIDKKLKAITLPSIPKLRYFTNDTLLDVLFYTSPVYCERIITAVAKEMNRLYAIFLARNPTYEGGVSVGGHSLGSLILFDLLSHQKPVGGLNSDDVKDSDTDDETLGKSPLLKGNSYISIPTATLGTSAPLIRYHQLSFQPRMFFAFGSPVGV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query214 2.2.26 [Sep-21-2011]
Q80Y98 699 Phospholipase DDHD2 OS=Mu yes N/A 0.766 0.234 0.537 3e-49
O94830 711 Phospholipase DDHD2 OS=Ho yes N/A 0.728 0.219 0.545 4e-49
Q6NZC7 998 SEC23-interacting protein no N/A 0.672 0.144 0.569 7e-48
Q9Y6Y8 1000 SEC23-interacting protein no N/A 0.672 0.144 0.569 1e-47
Q80YA3 547 Phospholipase DDHD1 OS=Mu no N/A 0.864 0.338 0.300 7e-17
Q12204 715 Probable phospholipase YO yes N/A 0.528 0.158 0.355 2e-16
O46606 875 Phospholipase DDHD1 OS=Bo no N/A 0.841 0.205 0.279 3e-16
Q8NEL9 900 Phospholipase DDHD1 OS=Ho no N/A 0.841 0.2 0.274 4e-16
P87109 757 Probable phospholipase C2 yes N/A 0.373 0.105 0.462 6e-15
Q7LKZ6 669 Probable phospholipase C1 no N/A 0.467 0.149 0.305 4e-08
>sp|Q80Y98|DDHD2_MOUSE Phospholipase DDHD2 OS=Mus musculus GN=Ddhd2 PE=1 SV=3 Back     alignment and function desciption
 Score =  194 bits (494), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 94/175 (53%), Positives = 126/175 (72%), Gaps = 11/175 (6%)

Query: 4   GSFCDLKFRPVVEVVDDFRSISLTLTASHFKSAADLGTLGRVEMLPISWHEALHSEESGI 63
           G  CDL+FR +V+ V+DFRS+SL L  +HFK A +   +GRVE LP++WH  LHS  +G+
Sbjct: 224 GPACDLRFRSIVQCVNDFRSVSLNLLQTHFKKAQENEQIGRVEFLPVNWHSPLHS--TGV 281

Query: 64  DKKLKAITLPSIPKLRYFTNDTLLDVLFYTSPVYCERIITAVAKEMNRLYAIFLARNPTY 123
           D  L+ ITLPSI +LR+FTNDT+LDV FY SP YC+ I+  VA EMNR+Y +FL RNP +
Sbjct: 282 DIDLQRITLPSINRLRHFTNDTILDVFFYNSPTYCQTIVDTVASEMNRIYTLFLQRNPDF 341

Query: 124 EGGVSVGGHSLGSLILFDLLSHQK-PVGGLNS--------DDVKDSDTDDETLGK 169
           +GGVS+ GHSLGSLILFD+L++QK  +G ++S        +D  D+ T +E L K
Sbjct: 342 KGGVSIAGHSLGSLILFDILTNQKNSIGDIDSEKGSLSSAEDRGDASTLEEDLKK 396
Phospholipase that hydrolyzes preferentially phosphatidic acid and phosphatidylethanolamine. May be involved in the maintenance of the endoplasmic reticulum and/or Golgi structures.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|O94830|DDHD2_HUMAN Phospholipase DDHD2 OS=Homo sapiens GN=DDHD2 PE=1 SV=2 Back     alignment and function description
>sp|Q6NZC7|S23IP_MOUSE SEC23-interacting protein OS=Mus musculus GN=Sec23ip PE=1 SV=2 Back     alignment and function description
>sp|Q9Y6Y8|S23IP_HUMAN SEC23-interacting protein OS=Homo sapiens GN=SEC23IP PE=1 SV=1 Back     alignment and function description
>sp|Q80YA3|DDHD1_MOUSE Phospholipase DDHD1 OS=Mus musculus GN=Ddhd1 PE=2 SV=1 Back     alignment and function description
>sp|Q12204|YOR22_YEAST Probable phospholipase YOR022C, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR022C PE=1 SV=1 Back     alignment and function description
>sp|O46606|DDHD1_BOVIN Phospholipase DDHD1 OS=Bos taurus GN=DDHD1 PE=1 SV=1 Back     alignment and function description
>sp|Q8NEL9|DDHD1_HUMAN Phospholipase DDHD1 OS=Homo sapiens GN=DDHD1 PE=1 SV=2 Back     alignment and function description
>sp|P87109|YDK2_SCHPO Probable phospholipase C20G8.02, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC20G8.02 PE=3 SV=1 Back     alignment and function description
>sp|Q7LKZ6|YJMD_SCHPO Probable phospholipase C1020.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1020.13c PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query214
347967742 1636 AGAP002379-PA [Anopheles gambiae str. PE 0.985 0.128 0.582 1e-66
383854368 1366 PREDICTED: uncharacterized protein LOC10 0.985 0.154 0.570 2e-66
350420444 1448 PREDICTED: hypothetical protein LOC10074 0.976 0.144 0.555 6e-66
170032833 1569 sec-23 interacting protein P125 [Culex q 0.957 0.130 0.587 1e-65
307211672 1445 Phospholipase DDHD2 [Harpegnathos saltat 0.985 0.146 0.551 2e-65
350420442 1435 PREDICTED: hypothetical protein LOC10074 0.962 0.143 0.566 4e-65
157104750 1587 sec-23 interacting protein P125 [Aedes a 0.985 0.132 0.595 8e-65
157124586 1580 sec-23 interacting protein P125 [Aedes a 0.985 0.133 0.595 1e-64
340709499 1436 PREDICTED: hypothetical protein LOC10064 0.962 0.143 0.562 2e-64
345497955 1407 PREDICTED: hypothetical protein LOC10011 0.971 0.147 0.56 3e-64
>gi|347967742|ref|XP_001237480.3| AGAP002379-PA [Anopheles gambiae str. PEST] gi|333468321|gb|EAU77131.3| AGAP002379-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 161/223 (72%), Gaps = 12/223 (5%)

Query: 4    GSFCDLKFRPVVEVVDDFRSISLTLTASHFKSAADLGTLGRVEMLPISWHEALHSEESGI 63
            G  CDL+FR V EVVD+FRSIS  L  SH++S+ D G +GRVE+LPISWH+ LHSEESG+
Sbjct: 1162 GEACDLRFRRVEEVVDEFRSISAQLVQSHYRSSFDRGDVGRVEILPISWHDDLHSEESGV 1221

Query: 64   DKKLKAITLPSIPKLRYFTNDTLLDVLFYTSPVYCERIITAVAKEMNRLYAIFLARNPTY 123
            D+KLK+ITLPSIPKLR+FTNDTLLDVLFYTSP++C+ II AV K +NRLYA+F  RNPT+
Sbjct: 1222 DEKLKSITLPSIPKLRHFTNDTLLDVLFYTSPMFCQSIIDAVGKSLNRLYALFCQRNPTF 1281

Query: 124  EGGVSVGGHSLGSLILFDLLSHQKPVGGLNSDDVKDSDT-DDET----------LGKSPL 172
             G VS+ GHSLGSLILFDLL HQK      S + ++S+  DD+T          +   PL
Sbjct: 1282 HGRVSLAGHSLGSLILFDLLCHQKRAEQKQSCEPENSENPDDDTVSPLTPHHAFVNHRPL 1341

Query: 173  L-KGNSYISIPTATLGTSAPLIRYHQLSFQPRMFFAFGSPVGV 214
            + K +  I+      GT  P I Y QL FQP+MFFA GSP+G+
Sbjct: 1342 VRKCSQQINYEVGPAGTGQPYITYPQLMFQPKMFFALGSPIGM 1384

Source: Anopheles gambiae str. PEST

Species: Anopheles gambiae

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383854368|ref|XP_003702693.1| PREDICTED: uncharacterized protein LOC100879519 [Megachile rotundata] Back     alignment and taxonomy information
>gi|350420444|ref|XP_003492511.1| PREDICTED: hypothetical protein LOC100746154 isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|170032833|ref|XP_001844284.1| sec-23 interacting protein P125 [Culex quinquefasciatus] gi|167873241|gb|EDS36624.1| sec-23 interacting protein P125 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|307211672|gb|EFN87693.1| Phospholipase DDHD2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|350420442|ref|XP_003492510.1| PREDICTED: hypothetical protein LOC100746154 isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|157104750|ref|XP_001648551.1| sec-23 interacting protein P125 [Aedes aegypti] gi|108869135|gb|EAT33360.1| AAEL014360-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|157124586|ref|XP_001654118.1| sec-23 interacting protein P125 [Aedes aegypti] gi|108873924|gb|EAT38149.1| AAEL009930-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|340709499|ref|XP_003393344.1| PREDICTED: hypothetical protein LOC100643273 [Bombus terrestris] Back     alignment and taxonomy information
>gi|345497955|ref|XP_003428106.1| PREDICTED: hypothetical protein LOC100118865 isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query214
FB|FBgn0031990 2016 CG8552 [Drosophila melanogaste 0.971 0.103 0.484 4.5e-45
UNIPROTKB|F1Q0P5 539 DDHD2 "Uncharacterized protein 0.663 0.263 0.520 4.7e-44
ZFIN|ZDB-GENE-030131-5259 977 sec23ip "SEC23 interacting pro 0.672 0.147 0.541 6.7e-44
UNIPROTKB|F1NXD7 1013 SEC23IP "Uncharacterized prote 0.672 0.142 0.513 9.8e-44
MGI|MGI:1919358 699 Ddhd2 "DDHD domain containing 0.696 0.213 0.506 1.5e-43
UNIPROTKB|O94830 711 DDHD2 "Phospholipase DDHD2" [H 0.696 0.209 0.506 4.8e-43
UNIPROTKB|F1MSS2 708 DDHD2 "Uncharacterized protein 0.663 0.200 0.520 6.2e-43
UNIPROTKB|F1RZJ5 715 DDHD2 "Uncharacterized protein 0.696 0.208 0.5 1.5e-42
UNIPROTKB|G3V8Q8 999 Sec23ip "Protein Sec23ip" [Rat 0.672 0.144 0.5 5e-42
MGI|MGI:2450915 998 Sec23ip "Sec23 interacting pro 0.672 0.144 0.493 1.3e-41
FB|FBgn0031990 CG8552 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 489 (177.2 bits), Expect = 4.5e-45, P = 4.5e-45
 Identities = 106/219 (48%), Positives = 132/219 (60%)

Query:     4 GSFCDLKFRPVVEVVDDFRSISLTLTASHFKSAADLGTLGRVEMLPISWHEALHSEESGI 63
             GS CDLK R V EVVDDFR I+  L  SH+K++ D+G +GRVE+LPISWH  LHSEE GI
Sbjct:  1555 GSACDLKMRSVEEVVDDFRVIAQQLVQSHYKNSTDMGLVGRVEVLPISWHGHLHSEELGI 1614

Query:    64 DKKLKAITLPSIPKLRYFTNDTLLDVLFYTSPVYCERIITAVAKEMNRLYAIFLARNPTY 123
             D+KLK+ITL SIP+LR FTNDTLLDVLFYTSP YC++I+  VA  +N +Y  +  R+P +
Sbjct:  1615 DEKLKSITLESIPRLRNFTNDTLLDVLFYTSPKYCQKIMNTVADALNDVYLKYRMRHPEF 1674

Query:   124 EXXXXXXXXXXXXXILFDLLSHQKPVG--------GLNSXXXXXXXXXXETLGKSPLLKG 175
                           ILFDLL HQ+P+           +           +     PL K 
Sbjct:  1675 NGGVSLAGHSLGSLILFDLLCHQEPLKESEEENKENPDQLPQKQSSQKVQLPTSDPLPKQ 1734

Query:   176 NSYISIPTATLGTSAPLIRYHQLSFQPRMFFAFGSPVGV 214
              SY   P    GT  P+I Y QL F P+ FFA GSP+G+
Sbjct:  1735 VSYAMGPE---GTGQPVITYTQLIFHPKKFFALGSPIGM 1770
GO:0008970 "phosphatidylcholine 1-acylhydrolase activity" evidence=ISS
GO:0046872 "metal ion binding" evidence=IEA
UNIPROTKB|F1Q0P5 DDHD2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5259 sec23ip "SEC23 interacting protein" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NXD7 SEC23IP "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1919358 Ddhd2 "DDHD domain containing 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|O94830 DDHD2 "Phospholipase DDHD2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MSS2 DDHD2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RZJ5 DDHD2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|G3V8Q8 Sec23ip "Protein Sec23ip" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2450915 Sec23ip "Sec23 interacting protein" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q80Y98DDHD2_MOUSE3, ., 1, ., 1, ., -0.53710.76630.2346yesN/A
O94830DDHD2_HUMAN3, ., 1, ., 1, ., -0.54540.72890.2194yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 214
KOG2308|consensus 741 100.0
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 97.04
KOG2308|consensus 741 96.45
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 96.45
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 96.43
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 96.07
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 96.0
PLN02733 440 phosphatidylcholine-sterol O-acyltransferase 95.93
PF02450 389 LCAT: Lecithin:cholesterol acyltransferase; InterP 95.67
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 95.48
PLN02454414 triacylglycerol lipase 95.13
PLN02761 527 lipase class 3 family protein 95.12
PLN02310 405 triacylglycerol lipase 95.1
PLN00413 479 triacylglycerol lipase 94.81
PRK10749 330 lysophospholipase L2; Provisional 94.7
PHA02857276 monoglyceride lipase; Provisional 94.45
TIGR01836 350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 94.37
PLN02211273 methyl indole-3-acetate methyltransferase 94.31
PLN02324 415 triacylglycerol lipase 94.23
PLN03037 525 lipase class 3 family protein; Provisional 93.97
PLN02408365 phospholipase A1 93.94
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 93.89
PRK10566249 esterase; Provisional 93.8
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 93.73
PRK10673255 acyl-CoA esterase; Provisional 93.7
KOG2564|consensus 343 93.58
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 93.53
PLN02571413 triacylglycerol lipase 93.38
COG2819264 Predicted hydrolase of the alpha/beta superfamily 93.33
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 93.29
PLN02385349 hydrolase; alpha/beta fold family protein 93.21
PLN02824 294 hydrolase, alpha/beta fold family protein 92.91
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 92.8
COG2267 298 PldB Lysophospholipase [Lipid metabolism] 92.78
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 92.67
PLN02298 330 hydrolase, alpha/beta fold family protein 92.65
PLN02753 531 triacylglycerol lipase 92.62
PRK11460232 putative hydrolase; Provisional 92.61
PLN02965255 Probable pheophorbidase 92.59
PF05277345 DUF726: Protein of unknown function (DUF726); Inte 92.43
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 92.43
PLN02802509 triacylglycerol lipase 92.28
PLN02162 475 triacylglycerol lipase 92.27
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 92.19
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 92.14
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 92.05
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 92.04
PRK10349256 carboxylesterase BioH; Provisional 92.01
COG3208244 GrsT Predicted thioesterase involved in non-riboso 92.01
PRK00870302 haloalkane dehalogenase; Provisional 92.01
PLN02719 518 triacylglycerol lipase 91.88
TIGR01607 332 PST-A Plasmodium subtelomeric family (PST-A). Thes 91.67
PLN02517 642 phosphatidylcholine-sterol O-acyltransferase 91.55
TIGR01250 288 pro_imino_pep_2 proline-specific peptidases, Bacil 91.5
PLN02934 515 triacylglycerol lipase 91.47
KOG2369|consensus 473 91.41
TIGR03611257 RutD pyrimidine utilization protein D. This protei 91.23
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 91.2
PRK11071190 esterase YqiA; Provisional 91.18
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 91.09
PF01083179 Cutinase: Cutinase; InterPro: IPR000675 Aerial pla 91.09
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 90.91
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 90.86
KOG1454|consensus 326 90.71
PF06259177 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR 90.67
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 90.6
PLN02511 388 hydrolase 90.56
COG3319 257 Thioesterase domains of type I polyketide synthase 90.48
PRK03204286 haloalkane dehalogenase; Provisional 89.87
PLN02652395 hydrolase; alpha/beta fold family protein 89.8
PRK06489 360 hypothetical protein; Provisional 89.76
PRK03592 295 haloalkane dehalogenase; Provisional 89.68
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 89.41
PLN02847 633 triacylglycerol lipase 89.07
PF00151331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 88.86
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 88.74
TIGR01392 351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 88.16
PLN03087 481 BODYGUARD 1 domain containing hydrolase; Provision 88.13
PLN02442283 S-formylglutathione hydrolase 88.11
PRK10985 324 putative hydrolase; Provisional 87.85
PRK07581 339 hypothetical protein; Validated 87.73
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 87.57
PRK08775 343 homoserine O-acetyltransferase; Provisional 87.21
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 86.76
PF11187224 DUF2974: Protein of unknown function (DUF2974); In 86.37
PLN00021313 chlorophyllase 86.2
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 86.19
PF02089 279 Palm_thioest: Palmitoyl protein thioesterase; Inte 86.14
smart00824212 PKS_TE Thioesterase. Peptide synthetases are invol 86.14
PF01674219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 86.07
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 85.97
PLN02894 402 hydrolase, alpha/beta fold family protein 85.9
PRK05855 582 short chain dehydrogenase; Validated 85.82
KOG4569|consensus336 85.36
KOG3724|consensus 973 85.21
PLN02578 354 hydrolase 84.95
TIGR01249 306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 84.54
PLN02679 360 hydrolase, alpha/beta fold family protein 83.66
COG0596 282 MhpC Predicted hydrolases or acyltransferases (alp 82.61
PRK13604 307 luxD acyl transferase; Provisional 82.34
PF07082250 DUF1350: Protein of unknown function (DUF1350); In 81.02
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 80.99
PLN02872 395 triacylglycerol lipase 80.96
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 80.63
TIGR03502 792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 80.01
>KOG2308|consensus Back     alignment and domain information 
Probab=100.00  E-value=8.3e-45  Score=351.51  Aligned_cols=204  Identities=39%  Similarity=0.633  Sum_probs=170.2

Q ss_pred             CCCCccCCCCcccHHHHHHHHHHHHHHHHHhhhhhhcccCCCCceEEeccccccccCCCCcccccccccccCCChhhhhh
Q psy12154          1 MSPGSFCDLKFRPVVEVVDDFRSISLTLTASHFKSAADLGTLGRVEMLPISWHEALHSEESGIDKKLKAITLPSIPKLRY   80 (214)
Q Consensus         1 ~GIG~~~d~r~~si~~~v~~fR~~~~~~l~~hf~~~~~~~~~~rV~~lPI~Wr~~l~~d~~~~~~~l~~It~~~i~~lR~   80 (214)
                      +|||  ||++.++|++|++.||....++.++||++-.++  ..||+||||+||  +.++....+..+++||+++++.+|.
T Consensus       299 hgig--~~~~~~~i~~n~~~~r~~~~~~~~sh~~~~~~r--~v~v~fLpv~w~--~~~~~~~~~~~v~~Itl~~i~~~R~  372 (741)
T KOG2308|consen  299 HGIG--QKMKDNSIIENVDSFRELPKALGESHLKNSSDR--PVRVLFLPVEWR--KGGEKTEDVNFVDDITLDSIPRKRI  372 (741)
T ss_pred             eccc--cCccccchhhcchhHHHHHHHHHHhhhccccCC--ccceeEEEeeee--EccchhccccchhhcccccchhHHh
Confidence            6999  678889999999999999999999999986654  789999999999  3333445567889999999999999


Q ss_pred             HhhhhhhhhhhccChhhHHHHHHHHHHHHHHHHHHHHHhCCCCCCcEEEEecChhHHHHHHHhhCCC-C-C-CCCCCC--
Q psy12154         81 FTNDTLLDVLFYTSPVYCERIITAVAKEMNRLYAIFLARNPTYEGGVSVGGHSLGSLILFDLLSHQK-P-V-GGLNSD--  155 (214)
Q Consensus        81 ~~n~~~lDvl~Y~sp~y~~~i~~~V~~~lN~~y~~F~~~nP~F~G~VsivgHSLGsvI~yDiL~~~~-~-~-~~e~~~--  155 (214)
                      ++|++++|||||+||.||+.|+..|+.++||+|.+|+.+||.|+|+|+|.||||||+|+|||||+|. . . .++-.|  
T Consensus       373 ~lnst~lDilyY~Splyrq~Iv~~V~~elNr~y~lf~~rnPef~G~Vsi~gHSLGSvit~Dil~~q~~P~~l~D~~ld~~  452 (741)
T KOG2308|consen  373 FLNSTALDILYYMSPLYRQEIVKGVARELNRLYALFKDRNPEFNGKVSIAGHSLGSVITYDILSHQRSPTFLLDELLDKL  452 (741)
T ss_pred             hccchhhhhcccCChHHHHHHHHHHHHHHHHHHHHHHhcChhhcCceeeccCCCCceEEEeecccccCcchhHHHHHhhh
Confidence            9999999999999999999999999999999999999999999999999999999999999999993 2 1 111111  


Q ss_pred             ------CCC--------CC-----CCCcccCCCcccccCCCcccccccccCCCCCccccCCCCCccCcEEEecCCCCC
Q psy12154        156 ------DVK--------DS-----DTDDETLGKSPLLKGNSYISIPTATLGTSAPLIRYHQLSFQPRMFFAFGSPVGV  214 (214)
Q Consensus       156 ------~~~--------~~-----~l~~~~~~pr~~~~~~~~~~~~~~~~g~~~~~~~~p~L~F~v~~fF~~GSPig~  214 (214)
                            .++        ..     -++++.+.|++++.    +.+..+..+.++|..+|++|+|+|++|||+||||||
T Consensus       453 ~~~e~e~~D~~~~~~~~q~~~~~~~l~~~~~~~~~~~~----~~~~~~~~~~~~~~~k~~qLeFkV~~fFalGSPlgv  526 (741)
T KOG2308|consen  453 LYEEPEYRDDILQSVESQKNKTYRLLKEFNPEPKGKVH----LSLESLIGGSGLPKTKYYQLEFKVDNFFALGSPLGV  526 (741)
T ss_pred             hcccccCcchHHHHHHhhhhhhhhhhhhhccCcccccc----hhhhhcccccccceeeeceeecchhheeeecCchhh
Confidence                  001        01     12333344444432    566777888899999999999999999999999997

>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>KOG2308|consensus Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>PLN02761 lipase class 3 family protein Back     alignment and domain information
>PLN02310 triacylglycerol lipase Back     alignment and domain information
>PLN00413 triacylglycerol lipase Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PLN02324 triacylglycerol lipase Back     alignment and domain information
>PLN03037 lipase class 3 family protein; Provisional Back     alignment and domain information
>PLN02408 phospholipase A1 Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>KOG2564|consensus Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02753 triacylglycerol lipase Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PLN02802 triacylglycerol lipase Back     alignment and domain information
>PLN02162 triacylglycerol lipase Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02719 triacylglycerol lipase Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PLN02517 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PLN02934 triacylglycerol lipase Back     alignment and domain information
>KOG2369|consensus Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>KOG1454|consensus Back     alignment and domain information
>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PLN02847 triacylglycerol lipase Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PF02089 Palm_thioest: Palmitoyl protein thioesterase; InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>KOG4569|consensus Back     alignment and domain information
>KOG3724|consensus Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query214
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 95.87
3lp5_A250 Putative cell surface hydrolase; structural genom 95.82
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 95.68
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 95.62
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 95.61
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 95.6
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 95.54
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 95.5
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 95.49
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 95.37
3h04_A275 Uncharacterized protein; protein with unknown func 95.31
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 95.26
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 95.17
1ei9_A 279 Palmitoyl protein thioesterase 1; alpha/beta hydro 94.94
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 94.93
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 94.9
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 94.86
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 94.82
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 94.82
1pja_A 302 Palmitoyl-protein thioesterase 2 precursor; hydrol 94.81
3o0d_A301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 94.78
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 94.65
3ngm_A319 Extracellular lipase; secret lipase, hydrolase; 2. 94.61
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 94.57
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 94.56
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 94.55
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 94.53
3tjm_A 283 Fatty acid synthase; thioesterase domain, fatty ac 94.53
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 94.45
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 94.4
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 94.39
3c5v_A 316 PME-1, protein phosphatase methylesterase 1; demet 94.39
3hju_A 342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 94.37
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 94.18
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 94.12
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 94.07
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 94.04
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 94.03
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 94.02
2yys_A 286 Proline iminopeptidase-related protein; TTHA1809, 94.0
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 93.98
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 93.94
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 93.94
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 93.79
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 93.77
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 93.76
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 93.74
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 93.71
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 93.7
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 93.65
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 93.62
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 93.61
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 93.61
1tht_A 305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 93.55
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 93.55
3llc_A270 Putative hydrolase; structural genomics, joint cen 93.53
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 93.53
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 93.52
1r3d_A264 Conserved hypothetical protein VC1974; structural 93.49
3qyj_A 291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 93.49
1k8q_A 377 Triacylglycerol lipase, gastric; APHA beta hydrola 93.49
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 93.47
3tej_A329 Enterobactin synthase component F; nonribosomal pe 93.47
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 93.44
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 93.43
1mtz_A 293 Proline iminopeptidase; alpha-beta hydrolase, CAP 93.42
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 93.39
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 93.38
2cjp_A 328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 93.37
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 93.37
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 93.36
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 93.34
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 93.33
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 93.3
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 93.25
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 93.21
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 93.2
3u1t_A 309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 93.19
1wm1_A 317 Proline iminopeptidase; complex with inhibitor, hy 93.18
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 93.18
3kda_A 301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 93.17
1xkl_A 273 SABP2, salicylic acid-binding protein 2; alpha-bet 93.13
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 93.13
1azw_A 313 Proline iminopeptidase; aminopeptidase, serine pro 93.11
3qit_A 286 CURM TE, polyketide synthase; thioesterase, alpha/ 93.06
1tca_A 317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 93.02
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 93.0
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 92.97
2psd_A 318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 92.97
1kez_A300 Erythronolide synthase; polyketide synthase, modul 92.97
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 92.95
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 92.94
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 92.93
1iup_A282 META-cleavage product hydrolase; aromatic compound 92.93
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 92.92
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 92.87
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 92.87
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 92.81
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 92.8
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 92.79
1q0r_A 298 RDMC, aclacinomycin methylesterase; anthracycline, 92.75
3nwo_A 330 PIP, proline iminopeptidase; structural genomics, 92.74
3r40_A 306 Fluoroacetate dehalogenase; FACD, defluorinase, al 92.69
2px6_A 316 Thioesterase domain; thioesaterse domain, orlistat 92.67
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 92.6
1ehy_A 294 Protein (soluble epoxide hydrolase); alpha/beta hy 92.59
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 92.54
3afi_E 316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 92.52
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 92.49
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 92.47
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 92.41
2rau_A 354 Putative esterase; NP_343859.1, putative lipase, s 92.39
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 92.38
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 92.15
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 92.02
2q0x_A 335 Protein DUF1749, uncharacterized protein; alpha/be 92.02
1gpl_A 432 RP2 lipase; serine esterase, hydrolase, lipid degr 91.97
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 91.93
4f0j_A 315 Probable hydrolytic enzyme; alpha/beta hydrolase f 91.93
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 91.86
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 91.84
3g9x_A 299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 91.84
1b6g_A 310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 91.81
2pl5_A 366 Homoserine O-acetyltransferase; alpha/beta hydrola 91.74
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 91.74
1j1i_A 296 META cleavage compound hydrolase; carbazole degrad 91.71
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 91.7
3i1i_A 377 Homoserine O-acetyltransferase; structural genomic 91.63
1vkh_A273 Putative serine hydrolase; structural genomics, jo 91.61
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 91.43
2x5x_A 342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 91.37
4fle_A202 Esterase; structural genomics, PSI-biology, northe 91.33
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 91.25
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 91.21
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 91.16
2qvb_A 297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 91.06
2y6u_A 398 Peroxisomal membrane protein LPX1; hydrolase, puta 91.05
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 91.05
1mj5_A 302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 90.97
2vat_A 444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 90.86
3b12_A 304 Fluoroacetate dehalogenase; dehalogease, hydrolase 90.19
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 90.66
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 90.53
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 90.45
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 90.36
1ex9_A 285 Lactonizing lipase; alpha-beta hydrolase fold, pho 90.28
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 90.24
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 90.15
2b61_A 377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 90.12
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 90.01
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 89.98
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 89.83
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 89.8
2ory_A346 Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph 89.49
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 89.4
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 89.26
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 89.1
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 89.01
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 89.0
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 88.91
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 88.77
1qoz_A207 AXE, acetyl xylan esterase; hydrolase, xylan degra 88.68
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 88.66
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 88.61
1g66_A207 Acetyl xylan esterase II; serine hydrolase, acetyl 88.49
3k2i_A 422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 88.42
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 88.18
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 88.05
2yij_A 419 Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid 87.8
1ys1_X 320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 87.59
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 87.54
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 87.52
2dsn_A 387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 87.47
2e3j_A 356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 87.28
2hdw_A 367 Hypothetical protein PA2218; alpha/beta hydrolase 87.09
3bjr_A283 Putative carboxylesterase; structural genomics, jo 86.81
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 86.76
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 86.71
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 86.58
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 86.42
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 86.29
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 85.99
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 85.95
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 85.95
4i19_A 388 Epoxide hydrolase; structural genomics, PSI-biolog 85.58
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 85.54
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 85.5
3hlk_A 446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 85.48
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 85.3
2hih_A 431 Lipase 46 kDa form; A1 phospholipase, phospholipid 85.11
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 84.65
3g02_A 408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 84.31
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 83.94
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 83.68
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 83.64
3gff_A 331 IROE-like serine hydrolase; NP_718593.1, structura 83.25
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 83.21
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 82.3
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 82.01
3hc7_A254 Gene 12 protein, GP12; alpha/beta sandwich, cell a 81.8
4f21_A246 Carboxylesterase/phospholipase family protein; str 81.29
3d59_A383 Platelet-activating factor acetylhydrolase; secret 81.21
3h2g_A 397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 80.73
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 80.36
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 80.16
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 80.02
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
Probab=95.87  E-value=0.011  Score=50.45  Aligned_cols=39  Identities=26%  Similarity=0.214  Sum_probs=27.4

Q ss_pred             HHHHHHHHHHHHHHHhCCCCCCcEEEEecChhHHHHHHHhh
Q psy12154        104 AVAKEMNRLYAIFLARNPTYEGGVSVGGHSLGSLILFDLLS  144 (214)
Q Consensus       104 ~V~~~lN~~y~~F~~~nP~F~G~VsivgHSLGsvI~yDiL~  144 (214)
                      .+..++-...+.+++++|  +.++.++||||||.+++-+-.
T Consensus       117 ~l~~~~~~~l~~~~~~~p--~~~i~~~GHSLGgalA~l~a~  155 (269)
T 1tgl_A          117 EVQNELVATVLDQFKQYP--SYKVAVTGHSLGGATALLCAL  155 (269)
T ss_pred             HHHHHHHHHHHHHHHHCC--CceEEEEeeCHHHHHHHHHHH
Confidence            344455455555666677  367999999999999986543
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30 Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A* Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>3hc7_A Gene 12 protein, GP12; alpha/beta sandwich, cell adhesion; 2.00A {Mycobacterium phage D29} Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query214
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 96.61
d1tcaa_ 317 Triacylglycerol lipase {Yeast (Candida antarctica) 96.41
d1pjaa_ 268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 96.32
d1ei9a_ 279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 96.28
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 95.78
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 95.77
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 95.76
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 95.53
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 95.52
d1xkta_ 286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 95.24
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 95.17
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 95.03
d1k8qa_ 377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 94.6
d1mtza_ 290 Tricorn interacting factor F1 {Archaeon Thermoplas 94.59
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 94.47
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 93.82
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 93.81
d1ex9a_ 285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 93.8
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 93.41
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 93.12
d1thta_ 302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 93.02
d1ehya_ 293 Bacterial epoxide hydrolase {Agrobacterium radioba 92.96
d1cvla_ 319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 92.52
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 92.46
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 92.34
d1mj5a_ 298 Haloalkane dehalogenase {Sphingomonas paucimobilis 92.08
d1azwa_ 313 Proline iminopeptidase {Xanthomonas campestris, pv 92.06
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 91.95
d1bn7a_ 291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 91.41
d1b6ga_ 310 Haloalkane dehalogenase {Xanthobacter autotrophicu 91.34
d1rp1a2 337 Pancreatic lipase, N-terminal domain {Dog (Canis f 91.31
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 91.16
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 90.8
d1zd3a2 322 Mammalian epoxide hydrolase, C-terminal domain {Hu 90.77
d1q0ra_ 297 Aclacinomycin methylesterase RdmC {Streptomyces pu 90.74
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 90.63
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 90.6
d1bu8a2 338 Pancreatic lipase, N-terminal domain {Rat (Rattus 89.92
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 89.92
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 89.42
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 89.13
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 88.96
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 88.65
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 88.21
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 87.94
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 87.88
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 86.37
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 86.0
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 85.05
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 84.64
d1pv1a_299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 84.06
d1g66a_207 Acetylxylan esterase {Penicillium purpurogenum [Ta 83.9
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 83.81
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 83.43
d1qoza_207 Acetylxylan esterase {Trichoderma reesei [TaxId: 5 83.1
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 81.36
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 81.0
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Bacterial lipase
domain: Lipase A
species: Bacillus subtilis [TaxId: 1423]

Probab=96.61  E-value=0.0013  Score=50.17  Aligned_cols=22  Identities=18%  Similarity=0.250  Sum_probs=19.4

Q ss_pred             CcEEEEecChhHHHHHHHhhCC
Q psy12154        125 GGVSVGGHSLGSLILFDLLSHQ  146 (214)
Q Consensus       125 G~VsivgHSLGsvI~yDiL~~~  146 (214)
                      .+|+||||||||+|+.-.+...
T Consensus        68 ~~v~lvGHSmGG~va~~~~~~~   89 (179)
T d1ispa_          68 KKVDIVAHSMGGANTLYYIKNL   89 (179)
T ss_dssp             SCEEEEEETHHHHHHHHHHHHS
T ss_pred             ceEEEEeecCcCHHHHHHHHHc
Confidence            5799999999999998888664
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g66a_ c.69.1.30 (A:) Acetylxylan esterase {Penicillium purpurogenum [TaxId: 28575]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure