Diaphorina citri psyllid: psy12170

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70---
MASDDESDVEEVVAFEIESSKHVQKYRPIALEDLLKQTKFTRQEIRVMYRGFKQFLTFIGLNHPTLKDNTNGI
ccccccccHHHHHHHHcccccccccccccHHHHHHHHccccHHHHHHHHHHHHHccccccccccccccccccc
************VAFEIESSKHVQKYRPIALEDLLKQTKFTRQEIRVMYRGFKQFLTFIGLNHPT********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASDDESDVEEVVAFEIESSKHVQKYRPIALEDLLKQTKFTRQEIRVMYRGFKQFLTFIGLNHPTLKDNTNGI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0016020 [CC]membraneprobableGO:0005575
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DD4, chain A
Confidence level:very confident
Coverage over the Query: 18-71
View the alignment between query and template
View the model in PyMOL