Psyllid ID: psy12170

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70---
MASDDESDVEEVVAFEIESSKHVQKYRPIALEDLLKQTKFTRQEIRVMYRGFKQFLTFIGLNHPTLKDNTNGI
ccccccccHHHHHHHHcccccccccccccHHHHHHHHccccHHHHHHHHHHHHHccccccccccccccccccc
ccccccccccEEEEEEEcccccccccccHHHHHHHHHccccHHHHHHHHHccHccccccEEcccccccccccc
masddesdVEEVVAFEIESSKHVQKYRPIALEDLLKQTKFTRQEIRVMYRGFKQFLTFiglnhptlkdntngi
MASDDESDVEEVVAFeiesskhvqkyrpIALEDLLKQTKFTRQEIRVMYRGFKQFLtfiglnhptlkdntngi
MASDDESDVEEVVAFEIESSKHVQKYRPIALEDLLKQTKFTRQEIRVMYRGFKQFLTFIGLNHPTLKDNTNGI
************VAFEIESSKHVQKYRPIALEDLLKQTKFTRQEIRVMYRGFKQFLTFIGLNH**********
*******************SKHVQKYRPIALEDLLKQTKFTRQEIRVMYRGFKQFLTFIGLNHPT********
***********VVAFEIESSKHVQKYRPIALEDLLKQTKFTRQEIRVMYRGFKQFLTFIGLNHPTLKDNTNGI
******SDVEEVVAFEIESSKHVQKYRPIALEDLLKQTKFTRQEIRVMYRGFKQFLTFIGLNHPTL*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASDDESDVEEVVAFEIESSKHVQKYRPIALEDLLKQTKFTRQEIRVMYRGFKQFLTFIGLNHPTLKDNTNGI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query73 2.2.26 [Sep-21-2011]
Q9NS61 270 Kv channel-interacting pr no N/A 0.479 0.129 0.538 0.0004
Q8WN03 270 Kv channel-interacting pr N/A N/A 0.479 0.129 0.538 0.0005
Q9JM59 270 Kv channel-interacting pr no N/A 0.479 0.129 0.538 0.0005
Q9JJ69 270 Kv channel-interacting pr no N/A 0.479 0.129 0.538 0.0005
>sp|Q9NS61|KCIP2_HUMAN Kv channel-interacting protein 2 OS=Homo sapiens GN=KCNIP2 PE=1 SV=3 Back     alignment and function desciption
 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/39 (53%), Positives = 28/39 (71%), Gaps = 4/39 (10%)

Query: 15  FEIESSKHVQKYRPIALEDLLKQTKFTRQEIRVMYRGFK 53
           FE+ +  H    RP  LE L +QTKFTR+E++V+YRGFK
Sbjct: 81  FELSTVCH----RPEGLEQLQEQTKFTRKELQVLYRGFK 115
Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Probably modulates channels density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND2/Kv4.2 and KCND3/Kv4.3 currents. Involved in KCND2 and KCND3 trafficking to the cell surface.
Homo sapiens (taxid: 9606)
>sp|Q8WN03|KCIP2_MUSPF Kv channel-interacting protein 2 OS=Mustela putorius furo GN=Kcnip2 PE=2 SV=1 Back     alignment and function description
>sp|Q9JM59|KCIP2_RAT Kv channel-interacting protein 2 OS=Rattus norvegicus GN=Kcnip2 PE=1 SV=2 Back     alignment and function description
>sp|Q9JJ69|KCIP2_MOUSE Kv channel-interacting protein 2 OS=Mus musculus GN=Kcnip2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query73
125777209 206 GA19207 [Drosophila pseudoobscura pseudo 0.698 0.247 0.660 3e-09
281362613 217 CG5890, isoform B [Drosophila melanogast 0.698 0.235 0.660 3e-09
24650168 206 CG5890, isoform A [Drosophila melanogast 0.698 0.247 0.660 4e-09
195391855 206 GJ22734 [Drosophila virilis] gi|19415266 0.698 0.247 0.660 4e-09
195062691 206 GH22305 [Drosophila grimshawi] gi|195453 0.698 0.247 0.660 4e-09
195110095 206 GI22974 [Drosophila mojavensis] gi|19391 0.698 0.247 0.660 4e-09
91077432 206 PREDICTED: similar to AGAP002000-PA [Tri 0.698 0.247 0.660 5e-09
383856279 220 PREDICTED: Kv channel-interacting protei 0.739 0.245 0.6 9e-09
383856277 208 PREDICTED: Kv channel-interacting protei 0.739 0.259 0.6 9e-09
32280224984 hypothetical protein SINV_01432 [Solenop 0.753 0.654 0.553 2e-08
>gi|125777209|ref|XP_001359531.1| GA19207 [Drosophila pseudoobscura pseudoobscura] gi|195152986|ref|XP_002017413.1| GL21539 [Drosophila persimilis] gi|54639275|gb|EAL28677.1| GA19207 [Drosophila pseudoobscura pseudoobscura] gi|194112470|gb|EDW34513.1| GL21539 [Drosophila persimilis] Back     alignment and taxonomy information
 Score = 65.9 bits (159), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 43/53 (81%), Gaps = 2/53 (3%)

Query: 1  MASDDESDVEEVVAFEIESSKHVQKYRPIALEDLLKQTKFTRQEIRVMYRGFK 53
          MAS  ES +EEVV +E+E ++ V K  P+ALEDL +QTKFT+QEIRVMYRGFK
Sbjct: 1  MASPPESPIEEVV-YELEQTR-VPKPIPVALEDLCRQTKFTKQEIRVMYRGFK 51

Source: Drosophila pseudoobscura pseudoobscura

Species: Drosophila pseudoobscura

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|281362613|ref|NP_001163739.1| CG5890, isoform B [Drosophila melanogaster] gi|272477184|gb|ACZ95033.1| CG5890, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|24650168|ref|NP_651436.1| CG5890, isoform A [Drosophila melanogaster] gi|194743744|ref|XP_001954360.1| GF16777 [Drosophila ananassae] gi|194908294|ref|XP_001981742.1| GG11429 [Drosophila erecta] gi|195349553|ref|XP_002041307.1| GM10270 [Drosophila sechellia] gi|195504205|ref|XP_002098981.1| GE23624 [Drosophila yakuba] gi|195574005|ref|XP_002104980.1| GD21239 [Drosophila simulans] gi|7301392|gb|AAF56519.1| CG5890, isoform A [Drosophila melanogaster] gi|190627397|gb|EDV42921.1| GF16777 [Drosophila ananassae] gi|190656380|gb|EDV53612.1| GG11429 [Drosophila erecta] gi|194123002|gb|EDW45045.1| GM10270 [Drosophila sechellia] gi|194185082|gb|EDW98693.1| GE23624 [Drosophila yakuba] gi|194200907|gb|EDX14483.1| GD21239 [Drosophila simulans] gi|223556036|gb|ACM90876.1| IP07559p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195391855|ref|XP_002054575.1| GJ22734 [Drosophila virilis] gi|194152661|gb|EDW68095.1| GJ22734 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195062691|ref|XP_001996239.1| GH22305 [Drosophila grimshawi] gi|195453827|ref|XP_002073961.1| GK12862 [Drosophila willistoni] gi|193899734|gb|EDV98600.1| GH22305 [Drosophila grimshawi] gi|194170046|gb|EDW84947.1| GK12862 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195110095|ref|XP_001999617.1| GI22974 [Drosophila mojavensis] gi|193916211|gb|EDW15078.1| GI22974 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|91077432|ref|XP_966445.1| PREDICTED: similar to AGAP002000-PA [Tribolium castaneum] gi|270001626|gb|EEZ98073.1| hypothetical protein TcasGA2_TC000480 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383856279|ref|XP_003703637.1| PREDICTED: Kv channel-interacting protein 1-like isoform 2 [Megachile rotundata] Back     alignment and taxonomy information
>gi|383856277|ref|XP_003703636.1| PREDICTED: Kv channel-interacting protein 1-like isoform 1 [Megachile rotundata] Back     alignment and taxonomy information
>gi|322802249|gb|EFZ22645.1| hypothetical protein SINV_01432 [Solenopsis invicta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query73
FB|FBgn0039380 217 CG5890 [Drosophila melanogaste 0.698 0.235 0.660 8.2e-12
UNIPROTKB|A6NN12 252 KCNIP2 "Kv channel interacting 0.643 0.186 0.471 1.4e-05
UNIPROTKB|F1N410 270 KCNIP2 "Uncharacterized protei 0.589 0.159 0.489 4.5e-05
UNIPROTKB|F1S8T5 270 KCNIP2 "Uncharacterized protei 0.589 0.159 0.489 4.5e-05
MGI|MGI:2135916 270 Kcnip2 "Kv channel-interacting 0.589 0.159 0.489 4.5e-05
RGD|70887 270 Kcnip2 "Kv channel-interacting 0.589 0.159 0.489 4.5e-05
UNIPROTKB|A6NFF4184 KCNIP2 "Kv channel-interacting 0.383 0.152 0.642 4.7e-05
UNIPROTKB|E1C338 233 KCNIP4 "Uncharacterized protei 0.780 0.244 0.389 9.1e-05
UNIPROTKB|Q9NS61 270 KCNIP2 "Kv channel-interacting 0.589 0.159 0.469 9.6e-05
UNIPROTKB|F1NHH8 196 KCNIP4 "Uncharacterized protei 0.726 0.270 0.396 0.00016
FB|FBgn0039380 CG5890 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 160 (61.4 bits), Expect = 8.2e-12, P = 8.2e-12
 Identities = 35/53 (66%), Positives = 43/53 (81%)

Query:     1 MASDDESDVEEVVAFEIESSKHVQKYRPIALEDLLKQTKFTRQEIRVMYRGFK 53
             MAS  ES +EEVV +E+E ++ V K  P+ALEDL +QTKFT+QEIRVMYRGFK
Sbjct:     1 MASPPESPIEEVV-YELEHTR-VPKPIPVALEDLCRQTKFTKQEIRVMYRGFK 51
GO:0005509 "calcium ion binding" evidence=ISS
GO:0048190 "wing disc dorsal/ventral pattern formation" evidence=IGI
GO:0048812 "neuron projection morphogenesis" evidence=IMP
UNIPROTKB|A6NN12 KCNIP2 "Kv channel interacting protein 2, isoform CRA_g" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1N410 KCNIP2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1S8T5 KCNIP2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:2135916 Kcnip2 "Kv channel-interacting protein 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|70887 Kcnip2 "Kv channel-interacting protein 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A6NFF4 KCNIP2 "Kv channel-interacting protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C338 KCNIP4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NS61 KCNIP2 "Kv channel-interacting protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NHH8 KCNIP4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 73
KOG0044|consensus 193 99.56
COG5126 160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 97.99
KOG0034|consensus 187 97.39
cd0005267 EH Eps15 homology domain; found in proteins implic 95.79
KOG0038|consensus 189 95.66
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 95.43
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 94.47
cd0008659 homeodomain Homeodomain; DNA binding domains invol 94.09
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 93.95
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 93.09
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 93.06
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 92.87
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 92.68
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 92.66
cd0503088 calgranulins Calgranulins: S-100 domain found in p 92.39
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 92.16
cd0021388 S-100 S-100: S-100 domain, which represents the la 92.03
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 92.01
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 91.5
PF0004657 Homeobox: Homeobox domain not present here.; Inter 91.03
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 90.83
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 90.69
cd0021388 S-100 S-100: S-100 domain, which represents the la 90.64
PTZ00183 158 centrin; Provisional 90.58
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 90.54
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 90.13
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 89.89
PTZ00184149 calmodulin; Provisional 89.13
PLN02964 644 phosphatidylserine decarboxylase 88.06
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 87.91
PTZ00183158 centrin; Provisional 87.41
PF1465866 EF-hand_9: EF-hand domain 85.01
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 84.81
KOG0041|consensus 244 84.69
cd04790172 HTH_Cfa-like_unk Helix-Turn-Helix DNA binding doma 84.24
KOG0028|consensus172 83.93
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 83.83
PTZ00184149 calmodulin; Provisional 83.36
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 83.22
PF04546211 Sigma70_ner: Sigma-70, non-essential region; Inter 82.6
>KOG0044|consensus Back     alignment and domain information 
Probab=99.56  E-value=4.9e-15  Score=104.52  Aligned_cols=49  Identities=35%  Similarity=0.497  Sum_probs=47.5

Q ss_pred             ccCCCHHHHHHHHhcCCCCHHHHHHHHHHhhcccCCCCcCHHHHhhhhc
Q psy12170         23 VQKYRPIALEDLLKQTKFTRQEIRVMYRGFKQFLTFIGLNHPTLKDNTN   71 (73)
Q Consensus        23 ~skls~e~l~~L~~~T~Fs~~EIk~lYk~FkkecPsG~Lt~~EFk~i~~   71 (73)
                      +++++|+.+++|.+.|+|+++||++|||+|+++||+|.++.++|+.||-
T Consensus         6 ~~~~~~~~~e~l~~~t~f~~~ei~~~Yr~Fk~~cP~G~~~~~~F~~i~~   54 (193)
T KOG0044|consen    6 NSKLQPESLEQLVQQTKFSKKEIQQWYRGFKNECPSGRLTLEEFREIYA   54 (193)
T ss_pred             cccCCcHHHHHHHHhcCCCHHHHHHHHHHhcccCCCCccCHHHHHHHHH
Confidence            7899999999999999999999999999999999999999999999984

>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>KOG0038|consensus Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>KOG0041|consensus Back     alignment and domain information
>cd04790 HTH_Cfa-like_unk Helix-Turn-Helix DNA binding domain of putative Cfa-like transcription regulators Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>PF04546 Sigma70_ner: Sigma-70, non-essential region; InterPro: IPR007631 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query73
3dd4_A 229 Structural Basis Of Kchip4a Modulation Of Kv4.3 Slo 1e-04
>pdb|3DD4|A Chain A, Structural Basis Of Kchip4a Modulation Of Kv4.3 Slow Inactivation Length = 229 Back     alignment and structure 
Iteration: 1

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 40/63 (63%), Gaps = 2/63 (3%)
Query: 6  ESDVEEVVAFEIESSKHVQKYRPIALEDLLKQTKFTRQEIRVMYRGFKQFLTFIGLNHPT 65
          E+ +E+ V  E+E +    ++RP ALE L  Q+KFT++E++++YRGFK       +N  T
Sbjct: 29 EAGLEDSVEDELEMA--TVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEET 86
Query: 66 LKD 68
           K+
Sbjct: 87 FKE 89

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query73
1s6c_A 183 KV4 potassium channel-interacting protein kchip1B; 5e-05
1bjf_A 193 Neurocalcin delta; calcium-binding, myristoylation 8e-05
3dd4_A 229 KV channel-interacting protein 4; EF-hands protein 2e-04
1g8i_A 190 Frequenin, neuronal calcium sensor 1; calcium bind 2e-04
2d8n_A 207 Recoverin; structural genomics, NPPSFA, national p 3e-04
2ct9_A 208 Calcium-binding protein P22; EF-hand, metal bindin 3e-04
2l2e_A 190 Calcium-binding protein NCS-1; NCS1P, myristoylate 3e-04
1dgu_A 183 Calcium-saturated CIB; helical, EF-hands, blood cl 5e-04
1fpw_A 190 Yeast frequenin, calcium-binding protein NCS-1; EF 5e-04
1s1e_A 224 KV channel interacting protein 1; kchip, calcium-b 6e-04
2jul_A 256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 6e-04
2l4h_A 214 Calcium and integrin-binding protein 1; metal bind 7e-04
2zfd_A 226 Calcineurin B-like protein 2; calcium binding prot 9e-04
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 Back     alignment and structure
 Score = 37.9 bits (88), Expect = 5e-05
 Identities = 16/29 (55%), Positives = 22/29 (75%)

Query: 26 YRPIALEDLLKQTKFTRQEIRVMYRGFKQ 54
          +RP  LE L  QT FT++E++V+YRGFK 
Sbjct: 1  HRPEGLEQLEAQTNFTKRELQVLYRGFKN 29
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Length = 214 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query73
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 99.64
1bjf_A 193 Neurocalcin delta; calcium-binding, myristoylation 98.8
3dd4_A 229 KV channel-interacting protein 4; EF-hands protein 98.79
2l4h_A 214 Calcium and integrin-binding protein 1; metal bind 98.78
1g8i_A 190 Frequenin, neuronal calcium sensor 1; calcium bind 98.73
1fpw_A 190 Yeast frequenin, calcium-binding protein NCS-1; EF 98.73
1s1e_A 224 KV channel interacting protein 1; kchip, calcium-b 98.61
2l2e_A 190 Calcium-binding protein NCS-1; NCS1P, myristoylate 98.57
2jul_A 256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 98.42
2ct9_A 208 Calcium-binding protein P22; EF-hand, metal bindin 98.28
2ehb_A 207 Calcineurin B-like protein 4; protein complex, Ca( 98.26
2d8n_A 207 Recoverin; structural genomics, NPPSFA, national p 98.2
1s6c_A 183 KV4 potassium channel-interacting protein kchip1B; 98.15
1jba_A 204 GCAP-2, protein (guanylate cyclase activating prot 98.14
2bec_A 202 Calcineurin B homologous protein 2; calcineurin-ho 98.07
2zfd_A 226 Calcineurin B-like protein 2; calcium binding prot 98.06
1dgu_A 183 Calcium-saturated CIB; helical, EF-hands, blood cl 97.66
3a8r_A 179 Putative uncharacterized protein; EF-hand, membran 97.55
2ggz_A 211 Guanylyl cyclase-activating protein 3; EF hand, gu 97.28
2r2i_A 198 Guanylyl cyclase-activating protein 1; EF hand, GC 96.57
2ovk_B 153 RLC, myosin regulatory light chain LC-2, mantle mu 96.13
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 95.98
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 95.81
3cs1_A 219 Flagellar calcium-binding protein; myristoylated, 95.67
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 95.67
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 95.65
1c07_A95 Protein (epidermal growth factor receptor pathway 95.5
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 95.48
1qjt_A99 EH1, epidermal growth factor receptor substrate su 95.45
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 95.43
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 95.37
3li6_A66 Calcium-binding protein; calcium signaling protein 95.37
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 95.36
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 95.32
3j04_B 143 Myosin regulatory light chain 2, smooth muscle MA 95.2
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 95.12
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 95.1
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 95.09
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 95.08
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 95.0
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 94.99
1wdc_C 156 Scallop myosin; calcium binding protein, muscle pr 94.95
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 94.95
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 94.94
2lhi_A 176 Calmodulin, serine/threonine-protein phosphatase c 94.94
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 94.9
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 94.78
2ovk_C 159 Myosin catalytic light chain LC-1, mantle muscle, 94.77
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 94.76
3pm8_A 197 PFCDPK2, calcium-dependent protein kinase 2; malar 94.76
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 94.74
3khe_A 191 Calmodulin-like domain protein kinase isoform 3; c 94.72
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 94.68
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 94.67
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 94.65
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 94.65
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 94.63
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 94.61
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 94.6
3akb_A166 Putative calcium binding protein; EF-hand, metal b 94.6
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 94.59
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 94.55
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 94.54
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 94.49
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 94.48
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 94.47
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 94.43
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 94.42
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 94.38
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 94.37
3k21_A 191 PFCDPK3, calcium-dependent protein kinase 3; calci 94.35
2lv7_A100 Calcium-binding protein 7; metal binding protein; 94.34
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 94.33
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 94.3
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 94.29
3i5g_B 153 Myosin regulatory light chain LC-2, mantle muscle; 94.28
2lmt_A 148 Calmodulin-related protein 97A; spermatogenesis, m 94.25
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 94.23
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 94.2
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 94.19
1avs_A90 Troponin C; muscle contraction, calcium-activated, 94.13
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 94.1
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 94.06
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 94.03
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 94.01
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 94.0
2mys_C 149 Myosin; muscle protein, motor protein; HET: MLY; 2 93.95
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 93.91
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 93.89
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 93.88
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 93.86
2jq6_A139 EH domain-containing protein 1; metal binding prot 93.86
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 93.78
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 93.74
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 93.73
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 93.73
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 93.58
3fwb_A161 Cell division control protein 31; gene gating, com 93.51
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 93.49
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 93.47
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 93.46
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 93.45
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 93.36
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 93.36
1wdc_B 156 Scallop myosin; calcium binding protein, muscle pr 93.35
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 93.33
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 93.32
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 93.28
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 93.25
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 93.23
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 93.21
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 93.15
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 93.14
2jnf_A158 Troponin C; stretch activated muscle contraction, 93.13
1exr_A148 Calmodulin; high resolution, disorder, metal trans 93.11
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 93.08
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 93.08
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 93.0
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 92.99
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 92.97
2jnf_A158 Troponin C; stretch activated muscle contraction, 92.97
3e3r_A 204 Calcyphosin, calcyphosine; human calcyphosine, EF- 92.95
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 92.91
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 92.87
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 92.86
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 92.84
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 92.8
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 92.75
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 92.72
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 92.66
1w7j_B 151 Myosin light chain 1; motor protein, unconventiona 92.65
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 92.62
1y1x_A191 Leishmania major homolog of programmed cell death 92.59
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 92.56
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 92.51
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 92.5
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 92.48
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 92.4
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 92.37
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 92.36
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 92.34
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 92.31
1y1x_A191 Leishmania major homolog of programmed cell death 92.26
2lv7_A100 Calcium-binding protein 7; metal binding protein; 92.18
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 92.11
1avs_A90 Troponin C; muscle contraction, calcium-activated, 92.09
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 92.09
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 92.06
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 92.06
1qv0_A 195 Obelin, OBL; photoprotein, bioluminescence, atomic 92.01
1exr_A148 Calmodulin; high resolution, disorder, metal trans 91.88
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 91.88
2hpk_A 208 Photoprotein berovin; structural genomics, PSI, pr 91.85
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 91.85
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 91.81
3fwb_A161 Cell division control protein 31; gene gating, com 91.78
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 91.78
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 91.75
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 91.73
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 91.72
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 91.69
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 91.68
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 91.65
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 91.65
2f2o_A 179 Calmodulin fused with calmodulin-binding domain of 91.64
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 91.59
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 91.53
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 91.52
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 91.52
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 91.45
2hps_A186 Coelenterazine-binding protein with bound coelent; 91.43
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 91.43
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 91.37
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 91.22
3dtp_E 196 RLC, myosin regulatory light chain; muscle protein 91.16
3a4u_B143 Multiple coagulation factor deficiency protein 2; 91.03
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 90.98
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 90.83
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 90.7
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 90.69
3ll8_B 155 Calcineurin subunit B type 1; protein-peptide dock 90.67
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 90.62
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 90.61
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 90.45
3sjs_A 220 URE3-BP sequence specific DNA binding protein; EF- 90.43
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 90.42
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 90.39
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 90.32
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 90.3
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 90.26
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 90.23
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 90.18
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 90.12
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 90.07
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 90.02
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 89.98
2e19_A64 Transcription factor 8; homeobox domain, structura 89.97
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 89.96
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 89.9
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 89.9
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 89.83
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 89.79
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 89.67
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 89.65
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 89.64
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 89.57
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 89.5
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 89.5
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 89.45
3a02_A60 Homeobox protein aristaless; homeodomain, developm 89.44
1q80_A 174 SCP, sarcoplasmic calcium-binding protein; all-alp 89.36
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 89.2
1c07_A95 Protein (epidermal growth factor receptor pathway 89.19
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 89.18
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 89.16
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 89.1
1uhs_A72 HOP, homeodomain only protein; structural genomics 89.07
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 89.0
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 89.0
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 88.95
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 88.95
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 88.91
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 88.9
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 88.89
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 88.79
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 88.69
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 88.69
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 88.68
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 88.68
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 88.59
2be4_A 272 Hypothetical protein LOC449832; DR.36843, BC083168 88.56
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 88.56
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 88.53
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 88.5
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 88.47
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 88.44
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 88.29
2bl0_C 142 Myosin regulatory light chain; muscle protein, sli 88.28
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 88.22
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 88.21
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 88.17
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 88.17
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 88.13
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 88.11
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 88.03
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 88.01
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 87.97
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 87.95
2r2i_A 198 Guanylyl cyclase-activating protein 1; EF hand, GC 87.84
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 87.83
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 87.79
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 87.76
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 87.72
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 87.68
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 87.6
2hps_A 186 Coelenterazine-binding protein with bound coelent; 87.6
3i5g_C 159 Myosin catalytic light chain LC-1, mantle muscle; 87.53
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 87.53
2obh_A 143 Centrin-2; DNA repair complex EF hand superfamily 87.46
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 87.11
1s6i_A 188 CDPK, calcium-dependent protein kinase SK5; EF-han 87.02
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 87.0
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 87.0
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 86.9
2ccm_A 191 Calexcitin; EF hand, calcium, signaling protein; 1 86.66
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 86.63
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 86.61
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 86.6
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 86.47
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 86.39
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 86.37
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 86.35
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 86.34
1jba_A 204 GCAP-2, protein (guanylate cyclase activating prot 86.32
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 86.12
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 86.09
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 86.01
3u0k_A 440 Rcamp; fluorescent protein, calcium binding, EF-ha 85.98
2sas_A 185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 85.85
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 85.64
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 85.61
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 85.47
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 85.41
3bow_A 714 Calpain-2 catalytic subunit; cysteine protease, in 85.31
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 85.29
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 85.24
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 85.23
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 85.15
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 85.06
1s1e_A 224 KV channel interacting protein 1; kchip, calcium-b 84.9
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 84.74
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 84.72
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 84.71
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 84.7
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 84.7
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 84.57
2lvv_A 226 Flagellar calcium-binding protein TB-24; EF-hand, 84.52
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 84.45
1ij5_A 323 Plasmodial specific LAV1-2 protein; fourty kDa cal 84.33
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 84.21
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 84.13
1wh5_A80 ZF-HD homeobox family protein; structural genomics 84.11
3lij_A494 Calcium/calmodulin dependent protein kinase with A 84.08
3a01_A93 Homeodomain-containing protein; homeodomain, prote 84.03
2be4_A 272 Hypothetical protein LOC449832; DR.36843, BC083168 83.97
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 83.74
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 83.7
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 83.65
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 83.45
2ggz_A 211 Guanylyl cyclase-activating protein 3; EF hand, gu 83.36
2dii_A61 TFIIH basal transcription factor complex P62 subun 82.95
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 82.91
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 82.91
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 82.9
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 82.88
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 82.81
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 82.69
3akb_A166 Putative calcium binding protein; EF-hand, metal b 82.4
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 82.15
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 81.39
2d8n_A 207 Recoverin; structural genomics, NPPSFA, national p 81.35
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 81.2
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 80.39
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 80.25
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
Probab=99.64  E-value=2.9e-17  Score=107.13  Aligned_cols=53  Identities=9%  Similarity=0.165  Sum_probs=50.9

Q ss_pred             ccccccCCCHHHHHHHHhcCCCCHHHHHHHHHHh-----hcccCCCCcCHHHHhhhhc
Q psy12170         19 SSKHVQKYRPIALEDLLKQTKFTRQEIRVMYRGF-----KQFLTFIGLNHPTLKDNTN   71 (73)
Q Consensus        19 ~~~~~skls~e~l~~L~~~T~Fs~~EIk~lYk~F-----kkecPsG~Lt~~EFk~i~~   71 (73)
                      ||+.+|+|+|+++++|.+.|+||++||++||++|     +++||+|.|+.++|+.||.
T Consensus         1 Mg~~~s~lspe~l~~L~~~t~fs~~elk~~y~~F~~g~~~k~cp~G~i~~e~F~~i~~   58 (118)
T 1tuz_A            1 MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLK   58 (118)
T ss_dssp             CCCCCSCSCHHHHHHHHHHHHHCCCCHHHHHHHHHTSGGGGGEETTEECHHHHHHHHH
T ss_pred             CCcccCcCCHHHHHHHHHHcccCHHHHHHHHHHHccccccccCCCCCCCHHHHHHHHH
Confidence            7889999999999999999999999999999999     6899999999999999985
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2dii_A TFIIH basal transcription factor complex P62 subunit; BTF2-P62, general transcription factor IIH polypeptide 1, nuclear protein; NMR {Homo sapiens} SCOP: a.240.1.1 Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 73
d1bjfa_ 181 a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId 2e-04
d1s6ca_ 178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 2e-04
d1g8ia_ 187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 3e-04
d1fpwa_ 190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 5e-04
d1omra_ 201 a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 8e-04
d1xo5a_ 180 a.39.1.5 (A:) Calcium- and integrin-binding protei 0.002
d2zfda1 183 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 { 0.002
d1tuza_118 a.39.1.7 (A:) Diacylglycerol kinase alpha, N-termi 0.002
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 Back     information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Neurocalcin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 35.2 bits (80), Expect = 2e-04
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 25 KYRPIALEDLLKQTKFTRQEIRVMYRGFKQ 54
          K RP  ++DLL+ T FT  EI+  Y+GF +
Sbjct: 3  KLRPEVMQDLLESTDFTEHEIQEWYKGFLR 32
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183 Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query73
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 99.51
d1fpwa_ 190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.36
d1bjfa_ 181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 99.2
d1omra_ 201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.18
d1g8ia_ 187 Frequenin (neuronal calcium sensor 1) {Human (Homo 99.14
d1jbaa_ 189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.13
d1s6ca_ 178 Kchip1, Kv4 potassium channel-interacting protein 98.89
d2zfda1 183 Calcineurin B-like protein 2 {Thale cress (Arabido 98.1
d1xo5a_ 180 Calcium- and integrin-binding protein, CIB {Human 98.02
d1auib_ 165 Calcineurin regulatory subunit (B-chain) {Human (H 97.49
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 96.45
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 96.41
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 96.09
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 96.06
d1lkja_ 146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 96.05
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 95.95
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 95.9
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 95.84
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 95.8
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 95.78
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 95.69
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 95.59
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 95.48
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 95.2
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 94.94
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 94.85
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 94.85
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 94.79
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 94.74
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 94.71
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 94.61
d2mysb_ 145 Myosin Essential Chain {Chicken (Gallus gallus) [T 94.56
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 94.52
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 94.42
d1exra_ 146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 94.35
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 94.33
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 94.31
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 94.25
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 94.2
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 94.18
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 94.17
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 93.91
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 93.89
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 93.88
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 93.67
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 93.67
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 93.66
d1dtla_ 156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 93.36
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 93.3
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 93.24
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 93.12
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 93.1
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 93.04
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 93.02
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 92.85
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 92.73
d2sasa_ 185 Sarcoplasmic calcium-binding protein {Amphioxus (B 92.71
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 92.64
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 92.64
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 92.61
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 92.6
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 92.53
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 92.18
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 91.95
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 91.91
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 91.88
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 91.86
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 91.8
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 91.8
d1nyaa_ 176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 91.7
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 91.7
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 91.61
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 91.55
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 91.5
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 91.41
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 91.4
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 91.36
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 91.25
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 91.02
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 90.96
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 90.77
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 90.61
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 90.58
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 90.5
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 90.32
d1wdcb_ 142 Myosin Essential Chain {Bay scallop (Aequipecten i 90.31
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 90.08
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 90.05
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 90.03
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 90.01
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 89.88
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 89.75
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 89.68
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 89.59
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 89.56
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 89.33
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 89.14
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 89.05
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 88.97
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 88.78
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 88.69
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 88.61
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 88.44
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 88.32
d1qv0a_ 189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 88.26
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 87.86
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 87.6
d1topa_ 162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 87.38
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 87.33
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 87.31
d2scpa_ 174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 87.25
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 87.2
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 86.8
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 86.7
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 86.58
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 86.42
d1wdcc_ 152 Myosin Regulatory Chain {Bay scallop (Aequipecten 86.34
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 86.07
d2zkmx1 170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 86.0
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 85.91
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 85.81
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 85.78
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 85.5
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 85.43
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 85.21
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 85.05
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 85.03
d1jbaa_ 189 Guanylate cyclase activating protein 2, GCAP-2 {Co 84.87
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 84.86
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 84.83
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 84.67
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 84.12
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 84.07
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 83.77
d1s6ia_ 182 Calcium-dependent protein kinase sk5 CLD {Soybean 82.84
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 82.47
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 82.06
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 81.92
d2obha1 141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 81.8
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 81.63
d1alva_ 173 Calpain small (regulatory) subunit (domain VI) {Pi 81.42
d2avue1156 Flagellar transcriptional activator FlhC {Escheric 80.95
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 80.28
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: EF-hand modules in multidomain proteins
domain: Diacylglycerol kinase alpha, N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.51  E-value=1.2e-15  Score=96.88  Aligned_cols=53  Identities=9%  Similarity=0.175  Sum_probs=50.2

Q ss_pred             ccccccCCCHHHHHHHHhcCCCCHHHHHHHHHHhh-----cccCCCCcCHHHHhhhhc
Q psy12170         19 SSKHVQKYRPIALEDLLKQTKFTRQEIRVMYRGFK-----QFLTFIGLNHPTLKDNTN   71 (73)
Q Consensus        19 ~~~~~skls~e~l~~L~~~T~Fs~~EIk~lYk~Fk-----kecPsG~Lt~~EFk~i~~   71 (73)
                      ||+.+|+|+|+++++|.+.|+||+.||++||++|+     +.||+|.|+.++|+.+|.
T Consensus         1 Mg~~~s~l~p~~l~~L~~~T~fs~~ei~~l~~~Fk~~~~~~~~p~g~i~~~~F~~~~~   58 (118)
T d1tuza_           1 MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLK   58 (118)
T ss_dssp             CCCCCSCSCHHHHHHHHHHHHHCCCCHHHHHHHHHTSGGGGGEETTEECHHHHHHHHH
T ss_pred             CCcccCCCCHHHHHHHHHHcCCCHHHHHHHHHHHhccccccCCcccccCHHHHHHHHH
Confidence            88999999999999999999999999999999996     469999999999999984
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2avue1 e.64.1.1 (E:5-160) Flagellar transcriptional activator FlhC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure