Diaphorina citri psyllid: psy12177


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160---
MFQGKLVVADMHVQMHAPGLVSTTNLCNIPYPYSQTVAPTMEEYLKTVEIKNFYTLGPVMANKITQQEQDELDWLTLQKKLQVGGYEQFTQETGTEKLIRKFKENPLVPIGCVATSAALGVGLYSMKLGDRRLSQMMMRTRVVAQGFTVLALTGGLIYTAYQT
cccccEEEEEEEEECcccccccccccccccccccccccccHHHHHHHHHccccEEcccccccccccccccccHHHHHHHHHccccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
****KLVVADMHVQMHAPGLVSTTNLCNIPYPYSQTVAPTMEEYLKTVEIKNFYTLGPVMANKITQQEQDELDWLTLQKKLQVGGYEQFTQETGTEKLIRKFKENPLVPIGCVATSAALGVGLYSMKLGDRRLSQMMMRTRVVAQGFTVLALTGGLIYTAYQ*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFQGKLVVADMHVQMHAPGLVSTTNLCNIPYPYSQTVAPTMEEYLKTVEIKNFYTLGPVMANKITQQEQDELDWLTLQKKLQVGGYEQFTQETGTEKLIRKFKENPLVPIGCVATSAALGVGLYSMKLGDRRLSQMMMRTRVVAQGFTVLALTGGLIYTAYQT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
HIG1 domain family member 2A, mitochondrial confidentQ9BW72
HIG1 domain family member 2A confidentQ9CQJ1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0043066 [BP]negative regulation of apoptotic processprobableGO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LON, chain A
Confidence level:very confident
Coverage over the Query: 87-163
View the alignment between query and template
View the model in PyMOL