Diaphorina citri psyllid: psy12189


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
MLTLFEVLSFKGWLDVRDILKTQLGDAHVIYIHVYIFLGCMIGLTLFVGVVIANYSENKGTALLTVDQRRWCDLKKRLKIAQPLHLPPRPDAFKYRARIYDVTQNLWFKRLIAAVVLINSMLLIVSLAPTV
ccccHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHEEEccccHHcccccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccc
MLTLFEVLSFKGWLDVRDILKTQLGDAHVIYIHVYIFLGCMIGLTLFVGVVIANYSENKGTALLTVDQRRWCDLKKRLKIAQPLHLPPRPDAFKYRARIYDVTQNLWFKRLIAAVVLINSMLLIVSLAPT*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLTLFEVLSFKGWLDVRDILKTQLGDAHVIYIHVYIFLGCMIGLTLFVGVVIANYSENKGTALLTVDQRRWCDLKKRLKIAQPLHLPPRPDAFKYRARIYDVTQNLWFKRLIAAVVLINSMLLIVSLAPTV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sodium leak channel non-selective protein Voltage-independent, cation-nonselective channel which is permeable to sodium, potassium and calcium ions. Responsible for the background sodium ion leak current in neurons and controls neuronal excitability. Activated either by neuropeptides substance P or neurotensin. Required for normal respiratory rhythm and neonatal survival.confidentQ8BXR5
Sodium leak channel non-selective protein Voltage-independent, cation-nonselective channel which is permeable to sodium, potassium and calcium ions. Responsible for the background sodium ion leak current in neurons and controls neuronal excitability. Activated either by neuropeptides substance P or neurotensin. Required for normal respiratory rhythm and neonatal survival.confidentQ6Q760
Sodium leak channel non-selective protein Voltage-independent, cation-nonselective channel which is permeable to sodium, potassium and calcium ions. Responsible for the background sodium ion leak current in neurons and controls neuronal excitability. Activated either by neuropeptides substance P or neurotensin. Required for normal respiratory rhythm and neonatal survival.confidentQ8IZF0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043679 [CC]axon terminusprobableGO:0044306, GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0033267, GO:0042995
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0048512 [BP]circadian behaviorprobableGO:0007623, GO:0007622, GO:0044708, GO:0050896, GO:0007610, GO:0048511, GO:0008150
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0050975 [BP]sensory perception of touchprobableGO:0032501, GO:0044707, GO:0050954, GO:0007600, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0072347 [BP]response to anestheticprobableGO:0008150, GO:0042221, GO:0050896, GO:0042493
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0008344 [BP]adult locomotory behaviorprobableGO:0007626, GO:0032501, GO:0044707, GO:0030534, GO:0044708, GO:0050896, GO:0007610, GO:0008150, GO:0044699
GO:0042752 [BP]regulation of circadian rhythmprobableGO:0008150, GO:0065007, GO:0050789
GO:0006811 [BP]ion transportprobableGO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0005244 [MF]voltage-gated ion channel activityprobableGO:0022891, GO:0022892, GO:0005215, GO:0005216, GO:0015075, GO:0022832, GO:0022857, GO:0015267, GO:0003674, GO:0022836, GO:0022803, GO:0022839, GO:0022838
GO:0055085 [BP]transmembrane transportprobableGO:0006810, GO:0009987, GO:0044765, GO:0008150, GO:0044763, GO:0051234, GO:0051179, GO:0044699
GO:0005272 [MF]sodium channel activityprobableGO:0022891, GO:0022890, GO:0022892, GO:0005261, GO:0015081, GO:0005215, GO:0005216, GO:0008324, GO:0022857, GO:0015075, GO:0015077, GO:0015267, GO:0003674, GO:0022803, GO:0046873, GO:0022838

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DXW, chain A
Confidence level:confident
Coverage over the Query: 1-59
View the alignment between query and template
View the model in PyMOL
Template: 1BYY, chain A
Confidence level:confident
Coverage over the Query: 61-80
View the alignment between query and template
View the model in PyMOL
Template: 3RVY, chain A
Confidence level:confident
Coverage over the Query: 95-130
View the alignment between query and template
View the model in PyMOL