Diaphorina citri psyllid: psy12192


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--
MLAREEIEYIIEEEVAKQTIRNWLEACLKKIRATNKQQTSLIAGLRATNEMLHMQDHLEDKTKDKQAEKDTDANEGLKRTKN
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHcccccccHHHHHHHHHHHccccccccc
****EEIEYIIEEEVAKQTIRNWLEACLKKIRATNKQ**S*IA*LR************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLAREEIEYIIEEEVAKQTIRNWLEACLKKIRATNKQQTSLIAGLRATNEMLHMQDHLEDKTKDKQAEKDTDANEGLKRTKN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048512 [BP]circadian behaviorprobableGO:0007623, GO:0007622, GO:0044708, GO:0050896, GO:0007610, GO:0048511, GO:0008150
GO:0043679 [CC]axon terminusprobableGO:0044306, GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0033267, GO:0042995
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

No confident structure templates for the query are predicted