Diaphorina citri psyllid: psy12202


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------
MLRKRSAVQLYSMVSCSTGCDPLSYKGYGCYCGFLGSGYPVDPIDRTSQLNMARDHDSGHEIYIIFIYSGVVSYTTGAIQGPTVLSFSNISSPTCGPASEDGPYVVSKASKRGKSCSHRLCECDRRFSECLRPYSCPKYKAVCRSNVFRLMQNLILI
ccccccHHHHHHHHHcccccccccccccccccccccccccccccccccHHccccHHcccccccccccccccCEEEEEEECccccccccccccccccccccccccEEECccccccHHHHHHHHHcHHHHHHHcccccccccccccccccccccccccc
****RSAVQLYSMVSCSTGCDPLSYKGYGCYCGFLGSGYPVDPIDRTSQLNMARDHDSGHEIYIIFIYSGVVSYTTGAIQGPTVLSFSNISSPTCGPASEDGPYVVSKASKRGKSCSHRLCECDRRFSECLRPYSCPKYKAVCRSNVFRLMQNLILI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRKRSAVQLYSMVSCSTGCDPLSYKGYGCYCGFLGSGYPVDPIDRTSQLNMARDHDSGHEIYIIFIYSGVVSYTTGAIQGPTVLSFSNISSPTCGPASEDGPYVVSKASKRGKSCSHRLCECDRRFSECLRPYSCPKYKAVCRSNVFRLMQNLILI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0047498 [MF]calcium-dependent phospholipase A2 activityprobableGO:0016787, GO:0016788, GO:0003824, GO:0003674, GO:0052689, GO:0004623, GO:0004620, GO:0016298

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GP7, chain A
Confidence level:very confident
Coverage over the Query: 6-81,92-96,111-143
View the alignment between query and template
View the model in PyMOL
Template: 1OZY, chain A
Confidence level:probable
Coverage over the Query: 8-131
View the alignment between query and template
View the model in PyMOL