Psyllid ID: psy12202
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 157 | ||||||
| 156540704 | 273 | PREDICTED: hypothetical protein LOC10011 | 0.840 | 0.483 | 0.451 | 3e-26 | |
| 380015133 | 173 | PREDICTED: phospholipase A2-like [Apis f | 0.840 | 0.763 | 0.451 | 2e-25 | |
| 66545346 | 162 | PREDICTED: phospholipase A2 homolog 1 [A | 0.840 | 0.814 | 0.451 | 2e-25 | |
| 383852970 | 222 | PREDICTED: phospholipase A2-like [Megach | 0.840 | 0.594 | 0.451 | 1e-24 | |
| 340728085 | 154 | PREDICTED: phospholipase A2 homolog 1-li | 0.847 | 0.863 | 0.448 | 2e-24 | |
| 350420396 | 154 | PREDICTED: phospholipase A2 homolog 1-li | 0.847 | 0.863 | 0.448 | 2e-24 | |
| 307180198 | 263 | Phospholipase A2-like protein 1 [Campono | 0.840 | 0.501 | 0.438 | 7e-24 | |
| 307209894 | 196 | Probable phospholipase A2 [Harpegnathos | 0.840 | 0.673 | 0.438 | 3e-23 | |
| 312374729 | 1463 | hypothetical protein AND_15595 [Anophele | 0.885 | 0.095 | 0.358 | 5e-23 | |
| 193610793 | 195 | PREDICTED: phospholipase A2-like [Acyrth | 0.757 | 0.610 | 0.392 | 3e-22 |
| >gi|156540704|ref|XP_001601787.1| PREDICTED: hypothetical protein LOC100117598 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Score = 123 bits (308), Expect = 3e-26, Method: Compositional matrix adjust.
Identities = 70/155 (45%), Positives = 93/155 (60%), Gaps = 23/155 (14%)
Query: 4 KRSAVQLYSMVSCSTGCDPLSYKGYGCYCGFLGSGYPVDPIDRTSQLNMARDHDSGHEIY 63
KR+ LY+M+ C+TGC+PL+YKGYGCYCGFLGSGYP+D IDR ++ HD +E
Sbjct: 140 KRAVTHLYNMIVCATGCNPLAYKGYGCYCGFLGSGYPMDGIDRCCKM-----HDWCYEAT 194
Query: 64 IIFIY-SGVVSYTTGAIQGPTVLSFSNISSPTCGPASEDGPYVVSKASKRGKSCSHRLCE 122
++ V Y +G P C A E G + S SC+ RLCE
Sbjct: 195 DCPMFVEYFVPYYWKCYRG---------YKPIC--AIEHGEWGSS------GSCAQRLCE 237
Query: 123 CDRRFSECLRPYSCPKYKAVCRSNVFRLMQNLILI 157
CDR F+ECLR Y CP++KAVC S+ +RL+QN+ +I
Sbjct: 238 CDRSFAECLRRYRCPRHKAVCTSSPWRLIQNIFMI 272
|
Source: Nasonia vitripennis Species: Nasonia vitripennis Genus: Nasonia Family: Pteromalidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|380015133|ref|XP_003691564.1| PREDICTED: phospholipase A2-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|66545346|ref|XP_624621.1| PREDICTED: phospholipase A2 homolog 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|383852970|ref|XP_003701998.1| PREDICTED: phospholipase A2-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|340728085|ref|XP_003402361.1| PREDICTED: phospholipase A2 homolog 1-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350420396|ref|XP_003492495.1| PREDICTED: phospholipase A2 homolog 1-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|307180198|gb|EFN68231.1| Phospholipase A2-like protein 1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|307209894|gb|EFN86673.1| Probable phospholipase A2 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|312374729|gb|EFR22222.1| hypothetical protein AND_15595 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|193610793|ref|XP_001948432.1| PREDICTED: phospholipase A2-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 157 | ||||||
| FB|FBgn0039655 | 373 | CG14507 [Drosophila melanogast | 0.745 | 0.313 | 0.370 | 8.6e-14 | |
| ZFIN|ZDB-GENE-040718-41 | 153 | zgc:92162 "zgc:92162" [Danio r | 0.267 | 0.274 | 0.5 | 1.1e-12 | |
| RGD|61949 | 146 | Pla2g1b "phospholipase A2, gro | 0.312 | 0.335 | 0.481 | 3.6e-12 | |
| UNIPROTKB|F1NZ96 | 142 | PLA2G2E "Uncharacterized prote | 0.210 | 0.232 | 0.575 | 9.2e-12 | |
| UNIPROTKB|E1C202 | 158 | PLA2G10 "Uncharacterized prote | 0.280 | 0.278 | 0.5 | 1.2e-11 | |
| UNIPROTKB|P04054 | 148 | PLA2G1B "Phospholipase A2" [Ho | 0.286 | 0.304 | 0.489 | 2.4e-11 | |
| MGI|MGI:101842 | 146 | Pla2g1b "phospholipase A2, gro | 0.312 | 0.335 | 0.462 | 3.1e-11 | |
| UNIPROTKB|I3LV50 | 146 | PLA2G1B "Phospholipase A2, maj | 0.343 | 0.369 | 0.448 | 3.9e-11 | |
| UNIPROTKB|F1NII2 | 154 | F1NII2 "Uncharacterized protei | 0.267 | 0.272 | 0.428 | 6.3e-11 | |
| UNIPROTKB|P04416 | 124 | P04416 "Phospholipase A2, mino | 0.299 | 0.379 | 0.490 | 8e-11 |
| FB|FBgn0039655 CG14507 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 184 (69.8 bits), Expect = 8.6e-14, P = 8.6e-14
Identities = 47/127 (37%), Positives = 62/127 (48%)
Query: 4 KRSAVQLYSMVSCSTGCDPLSYKGYGCYCGFLGSGYPVDPIDRTSQLNMARDHDSGHEIY 63
KR +LYSM+ CSTGCDPL YKGYGCYCGF G G P D IDR +++ D G
Sbjct: 241 KRDVARLYSMIKCSTGCDPLIYKGYGCYCGFGGHGVPADGIDRCCRVH---DKCYGQSNC 297
Query: 64 IIFIYSGVVSYTTGAIQGPTVLSFSN--ISSP-TCGPASEDGPYVVSKASKRGKSCSHR- 119
I ++ V Y +G + + + P +C +S+ KR C HR
Sbjct: 298 ISYL-EYFVPYVWKCYRGKPLCAVDHGEFGGPDSCAARLCQCDLRLSRCLKR-YYCPHRR 355
Query: 120 -LCECDR 125
+C R
Sbjct: 356 SICHSSR 362
|
|
| ZFIN|ZDB-GENE-040718-41 zgc:92162 "zgc:92162" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|61949 Pla2g1b "phospholipase A2, group IB, pancreas" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NZ96 PLA2G2E "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C202 PLA2G10 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P04054 PLA2G1B "Phospholipase A2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:101842 Pla2g1b "phospholipase A2, group IB, pancreas" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LV50 PLA2G1B "Phospholipase A2, major isoenzyme" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NII2 F1NII2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P04416 P04416 "Phospholipase A2, minor isoenzyme" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 157 | |||
| cd00125 | 115 | cd00125, PLA2c, PLA2c: Phospholipase A2, a family | 8e-18 | |
| pfam00068 | 116 | pfam00068, Phospholip_A2_1, Phospholipase A2 | 2e-09 | |
| smart00085 | 117 | smart00085, PA2c, Phospholipase A2 | 2e-06 | |
| cd04707 | 117 | cd04707, otoconin_90, otoconin_90: Phospholipase A | 1e-05 |
| >gnl|CDD|153091 cd00125, PLA2c, PLA2c: Phospholipase A2, a family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent | Back alignment and domain information |
|---|
Score = 73.8 bits (182), Expect = 8e-18
Identities = 48/145 (33%), Positives = 58/145 (40%), Gaps = 47/145 (32%)
Query: 6 SAVQLYSMVSCSTGCDPLSYKGYGCYCGFLGSGYPVDPIDRTSQLNMARDHD-------- 57
+ +Q M+ C+TG L Y GYGCYCG GSG PVD DR Q+ HD
Sbjct: 1 NLLQFGKMIKCTTGRSALDYNGYGCYCGLGGSGTPVDDTDRCCQV-----HDCCYDRAEK 55
Query: 58 SGHEIYIIFIYSGVVSYTTGAIQGPTVLSFSNISSPTCGPASEDGPYVVSKASKRGKSCS 117
G Y Y SYT S+ TC A+ C+
Sbjct: 56 GGCSPYFT-SY----SYT-----------CSD-GQITCSDAN--------------DKCA 84
Query: 118 HRLCECDRRFSECLR--PYSCPKYK 140
LCECDR + C PY PKY+
Sbjct: 85 RALCECDRAAALCFARAPY-NPKYR 108
|
PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids (PC or phosphatidylethanolamine), usually in a metal-dependent reaction, to generate lysophospholipid (LysoPL) and a free fatty acid (FA). The resulting products are either dietary or used in synthetic pathways for leukotrienes and prostaglandins. Often, arachidonic acid is released as a free fatty acid and acts as second messenger in signaling networks. Secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis (LysoPL and FA) cannot form bilayers leading to a change in membrane conformation and ultimately to a block in the release of neurotransmitters. PLA2 may form dimers or oligomers. Length = 115 |
| >gnl|CDD|200972 pfam00068, Phospholip_A2_1, Phospholipase A2 | Back alignment and domain information |
|---|
| >gnl|CDD|214508 smart00085, PA2c, Phospholipase A2 | Back alignment and domain information |
|---|
| >gnl|CDD|153096 cd04707, otoconin_90, otoconin_90: Phospholipase A2-like domains present in otoconin-90 and otoconin-95, mammal proteins that are principal matrix proteins of calcitic otoconia | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 157 | |||
| cd00125 | 115 | PLA2c PLA2c: Phospholipase A2, a family of secreto | 100.0 | |
| cd04707 | 117 | otoconin_90 otoconin_90: Phospholipase A2-like dom | 100.0 | |
| KOG4087|consensus | 144 | 100.0 | ||
| PF00068 | 116 | Phospholip_A2_1: Phospholipase A2; InterPro: IPR00 | 100.0 | |
| smart00085 | 117 | PA2c Phospholipase A2. | 100.0 | |
| cd00618 | 83 | PLA2_like PLA2_like: Phospholipase A2, a super-fam | 99.86 | |
| cd04706 | 117 | PLA2_plant PLA2_plant: Plant-specific sub-family o | 99.17 | |
| cd04704 | 97 | PLA2_bee_venom_like PLA2_bee_venom_like: A sub-fam | 98.51 | |
| PF05826 | 99 | Phospholip_A2_2: Phospholipase A2; InterPro: IPR00 | 96.88 | |
| PF08398 | 64 | Parvo_coat_N: Parvovirus coat protein VP1; InterPr | 96.55 | |
| cd04705 | 100 | PLA2_group_III_like PLA2_group_III_like: A sub-fam | 94.01 |
| >cd00125 PLA2c PLA2c: Phospholipase A2, a family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent | Back alignment and domain information |
|---|
Probab=100.00 E-value=8e-40 Score=247.63 Aligned_cols=106 Identities=37% Similarity=0.660 Sum_probs=98.0
Q ss_pred cHHHHHHHHhhhcCCCcccccCCccccCCCCCCCCcCccCCccccccccchhhHHhhhhhcccCCc-ceeeEEeecCCcc
Q psy12202 6 SAVQLYSMVSCSTGCDPLSYKGYGCYCGFLGSGYPVDPIDRTSQLNMARDHDSGHEIYIIFIYSGV-VSYTTGAIQGPTV 84 (157)
Q Consensus 6 ~l~qf~~Mi~c~tg~~~l~Y~~YGCyCg~gG~G~PVD~iDrcC~~~~~~~Hd~CY~~~~~~~c~~~-~~Y~~~~~~~~~~ 84 (157)
+|+||++||+|+||++|++|++||||||+||+|+|||+|||||+. ||.||+.+....|.|+ .+|+|++.++
T Consensus 1 ~l~qf~~MI~c~tgr~~~~Y~~YGCyCG~GG~G~PvD~~DrCC~~-----HD~CY~~~~~~~C~p~~~~Y~y~~~~~--- 72 (115)
T cd00125 1 NLLQFGKMIKCTTGRSALDYNGYGCYCGLGGSGTPVDDTDRCCQV-----HDCCYDRAEKGGCSPYFTSYSYTCSDG--- 72 (115)
T ss_pred CHHHHHHHHHHhcCCCHHHHhhcCCccCCCCCCCCcccHHHHHHH-----HHhHHhccccCCCccccccceEEEECC---
Confidence 589999999999999999999999999999999999999999999 9999999976778887 9999999877
Q ss_pred cccCCCCCceeCCCCCCCCceeeccCCCCChhhhhhchhhHHHHHHhccCCCCCCc
Q psy12202 85 LSFSNISSPTCGPASEDGPYVVSKASKRGKSCSHRLCECDRRFSECLRPYSCPKYK 140 (157)
Q Consensus 85 ~s~~~~~~i~C~~~~~~~~~~~~~~~~~~~~C~~~lCeCDr~~A~C~~~~~~~~~~ 140 (157)
.|+|. +..++|+++||||||++|+||++++|+.+.
T Consensus 73 -------~i~C~--------------~~~~~C~~~~CeCDr~aa~Cf~~~~yn~~~ 107 (115)
T cd00125 73 -------QITCS--------------DANDKCARALCECDRAAALCFARAPYNPKY 107 (115)
T ss_pred -------cceEC--------------cCCChHhHHHhHccHHHHHHHhhCcCChhh
Confidence 89994 456899999999999999999999987653
|
PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids (PC or phosphatidylethanolamine), usually in a metal-dependent reaction, to generate lysophospholipid (LysoPL) and a free fatty acid (FA). The resulting products are either dietary or used in synthetic pathways for leukotrienes and prostaglandins. Often, arachidonic acid is released as a free fatty acid and acts as second messenger in signaling networks. Secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis (LysoPL and FA) cannot form bilayers leading to a change in membrane conformation and ultimately to a block in |
| >cd04707 otoconin_90 otoconin_90: Phospholipase A2-like domains present in otoconin-90 and otoconin-95, mammal proteins that are principal matrix proteins of calcitic otoconia | Back alignment and domain information |
|---|
| >KOG4087|consensus | Back alignment and domain information |
|---|
| >PF00068 Phospholip_A2_1: Phospholipase A2; InterPro: IPR001211 Phospholipase A2 (3 | Back alignment and domain information |
|---|
| >smart00085 PA2c Phospholipase A2 | Back alignment and domain information |
|---|
| >cd00618 PLA2_like PLA2_like: Phospholipase A2, a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent | Back alignment and domain information |
|---|
| >cd04706 PLA2_plant PLA2_plant: Plant-specific sub-family of Phospholipase A2, a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent | Back alignment and domain information |
|---|
| >cd04704 PLA2_bee_venom_like PLA2_bee_venom_like: A sub-family of Phospholipase A2, similar to bee venom PLA2 | Back alignment and domain information |
|---|
| >PF05826 Phospholip_A2_2: Phospholipase A2; InterPro: IPR001211 Phospholipase A2 (3 | Back alignment and domain information |
|---|
| >PF08398 Parvo_coat_N: Parvovirus coat protein VP1; InterPro: IPR013607 Parvoviruses are some of the smallest viruses containing linear, non-segmented single-stranded DNA genomes, with an average genome size of 5000 nucleotides | Back alignment and domain information |
|---|
| >cd04705 PLA2_group_III_like PLA2_group_III_like: A sub-family of Phospholipase A2, similar to human group III PLA2 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 157 | ||||
| 3elo_A | 133 | Crystal Structure Of Human Pancreatic Prophospholip | 1e-05 | ||
| 3v9m_A | 118 | Phospholipase Acii4 From Australian King Brown Snak | 2e-05 | ||
| 1hn4_A | 131 | Prophospholipase A2 Dimer Complexed With Mj33, Sulf | 5e-05 | ||
| 3g8g_A | 122 | Crystal Structure Of Phospholipase A2 Ammodytoxin A | 5e-05 | ||
| 3g8h_A | 122 | Crystal Structure Of Phospholipase A2 Ammodytoxin C | 5e-05 | ||
| 2bp2_A | 130 | The Structure Of Bovine Pancreatic Prophospholipase | 6e-05 | ||
| 4bp2_A | 130 | Crystallographic Refinement Of Bovine Pro-Phospholi | 7e-05 | ||
| 1p7o_A | 124 | Crystal Structure Of Phospholipase A2 (Mipla4) From | 7e-05 | ||
| 1tgm_A | 121 | Crystal Structure Of A Complex Formed Between Group | 8e-05 | ||
| 1pwo_A | 124 | Crystal Structure Of Phospholipase A2 (Mipla2) From | 8e-05 | ||
| 1ozy_A | 121 | Crystal Structure Of Phospholipase A2 (mipla3) From | 1e-04 | ||
| 5p2p_A | 119 | X-Ray Structure Of Phospholipase A2 Complexed With | 1e-04 | ||
| 1po8_A | 118 | Crystal Structure Of A Complex Formed Between Krait | 1e-04 | ||
| 1cl5_A | 121 | Crystal Structure Of Phospholipase A2 From Daboia R | 2e-04 | ||
| 2phi_A | 124 | A Large Conformational Change Is Found In The Cryst | 2e-04 | ||
| 1oyf_B | 121 | Crystal Structure Of Russelles Viper (Daboia Russel | 2e-04 | ||
| 1oyf_A | 121 | Crystal Structure Of Russelles Viper (Daboia Russel | 2e-04 | ||
| 1fx9_A | 124 | Carboxylic Ester Hydrolase Complex (Dimeric Pla2 + | 2e-04 | ||
| 2zp4_A | 123 | Carboxylic Ester Hydrolase, Single Mutant H48n Of B | 2e-04 | ||
| 3p2p_A | 119 | Enhanced Activity And Altered Specificity Of Phosph | 2e-04 | ||
| 1dpy_A | 118 | Three-Dimensional Structure Of A Novel Phospholipas | 3e-04 | ||
| 1gp7_A | 151 | Acidic Phospholipase A2 From Venom Of Ophiophagus H | 5e-04 | ||
| 1gh4_A | 123 | Structure Of The Triple Mutant (K56m, K120m, K121m) | 5e-04 | ||
| 1y6o_A | 131 | Crystal Structure Of Disulfide Engineered Porcine P | 6e-04 | ||
| 1mks_A | 123 | Carboxylic Ester Hydrolase, Trigonal Form Of The Tr | 6e-04 | ||
| 1fe5_A | 118 | Sequence And Crystal Structure Of A Basic Phospholi | 6e-04 | ||
| 1bpq_A | 123 | Phospholipase A2 Engineering. X-Ray Structural And | 6e-04 | ||
| 1irb_A | 123 | Carboxylic Ester Hydrolase Length = 123 | 7e-04 | ||
| 2bch_A | 123 | A Possible Of Second Calcium Ion In Interfacial Bin | 7e-04 | ||
| 1c74_A | 123 | Structure Of The Double Mutant (K53,56m) Of Phospho | 7e-04 | ||
| 2zp3_A | 123 | Carboxylic Ester Hydrolase, Single Mutant D49n Of B | 7e-04 | ||
| 1ceh_A | 123 | Structure And Function Of The Catalytic Site Mutant | 7e-04 | ||
| 1vl9_A | 123 | Atomic Resolution (0.97a) Structure Of The Triple M | 7e-04 | ||
| 1o2e_A | 123 | Structure Of The Triple Mutant (K53,56,120m) + Anis | 7e-04 | ||
| 1g2x_A | 118 | Sequence Induced Trimerization Of Krait Pla2: Cryst | 7e-04 | ||
| 1kvx_A | 123 | Carboxylic Ester Hydrolase, Single Mutant D99a Of B | 7e-04 | ||
| 1kvy_A | 123 | Carboxylic Ester Hydrolase, Single Mutant D49e Coor | 7e-04 | ||
| 2zp5_A | 123 | Carboxylic Ester Hydrolase, Single Mutant D49k Of B | 7e-04 | ||
| 1kvw_A | 123 | Carboxylic Ester Hydrolase, Single Mutant H48q Of B | 7e-04 | ||
| 1bvm_A | 123 | Solution Nmr Structure Of Bovine Pancreatic Phospho | 7e-04 | ||
| 3bp2_A | 123 | Role Of The N-Terminus In The Interaction Of Pancre | 7e-04 | ||
| 1bjj_A | 122 | Agkistrodotoxin, A Phospholipase A2-Type Presynapti | 8e-04 |
| >pdb|3ELO|A Chain A, Crystal Structure Of Human Pancreatic Prophospholipase A2 Length = 133 | Back alignment and structure |
|
| >pdb|3V9M|A Chain A, Phospholipase Acii4 From Australian King Brown Snake Length = 118 | Back alignment and structure |
| >pdb|1HN4|A Chain A, Prophospholipase A2 Dimer Complexed With Mj33, Sulfate, And Calcium Length = 131 | Back alignment and structure |
| >pdb|3G8G|A Chain A, Crystal Structure Of Phospholipase A2 Ammodytoxin A From Vipera Ammodytes Ammodytes Length = 122 | Back alignment and structure |
| >pdb|3G8H|A Chain A, Crystal Structure Of Phospholipase A2 Ammodytoxin C From Vipera Ammodytes Ammodytes Length = 122 | Back alignment and structure |
| >pdb|2BP2|A Chain A, The Structure Of Bovine Pancreatic Prophospholipase A2 At 3.0 Angstroms Resolution Length = 130 | Back alignment and structure |
| >pdb|4BP2|A Chain A, Crystallographic Refinement Of Bovine Pro-Phospholipase A2 At 1.6 Angstroms Resolution Length = 130 | Back alignment and structure |
| >pdb|1P7O|A Chain A, Crystal Structure Of Phospholipase A2 (Mipla4) From Micropechis Ikaheka Length = 124 | Back alignment and structure |
| >pdb|1TGM|A Chain A, Crystal Structure Of A Complex Formed Between Group Ii Phospholipase A2 And Aspirin At 1.86 A Resolution Length = 121 | Back alignment and structure |
| >pdb|1PWO|A Chain A, Crystal Structure Of Phospholipase A2 (Mipla2) From Micropechis Ikaheka Length = 124 | Back alignment and structure |
| >pdb|1OZY|A Chain A, Crystal Structure Of Phospholipase A2 (mipla3) From Micropechis Ikaheka Length = 121 | Back alignment and structure |
| >pdb|5P2P|A Chain A, X-Ray Structure Of Phospholipase A2 Complexed With A Substrate-Derived Inhibitor Length = 119 | Back alignment and structure |
| >pdb|1PO8|A Chain A, Crystal Structure Of A Complex Formed Between Krait Venom Phospholipase A2 And Heptanoic Acid At 2.7 A Resolution. Length = 118 | Back alignment and structure |
| >pdb|1CL5|A Chain A, Crystal Structure Of Phospholipase A2 From Daboia Russelli Pulchella Length = 121 | Back alignment and structure |
| >pdb|2PHI|A Chain A, A Large Conformational Change Is Found In The Crystal Structure Of The Porcine Pancreatic Phospholipase A2 Point Mutant F63v Length = 124 | Back alignment and structure |
| >pdb|1OYF|B Chain B, Crystal Structure Of Russelles Viper (Daboia Russellii Pulchella) Phospholipase A2 In A Complex With Venom 6- Methyl Heptanol Length = 121 | Back alignment and structure |
| >pdb|1OYF|A Chain A, Crystal Structure Of Russelles Viper (Daboia Russellii Pulchella) Phospholipase A2 In A Complex With Venom 6- Methyl Heptanol Length = 121 | Back alignment and structure |
| >pdb|1FX9|A Chain A, Carboxylic Ester Hydrolase Complex (Dimeric Pla2 + Mj33 Inhibitor + Sulphate Ions) Length = 124 | Back alignment and structure |
| >pdb|2ZP4|A Chain A, Carboxylic Ester Hydrolase, Single Mutant H48n Of Bovine Pancreatic Pla2 Enzyme Length = 123 | Back alignment and structure |
| >pdb|3P2P|A Chain A, Enhanced Activity And Altered Specificity Of Phospholipase A2 By Deletion Of A Surface Loop Length = 119 | Back alignment and structure |
| >pdb|1DPY|A Chain A, Three-Dimensional Structure Of A Novel Phospholipase A2 From Indian Common Krait At 2.45 A Resolution Length = 118 | Back alignment and structure |
| >pdb|1GP7|A Chain A, Acidic Phospholipase A2 From Venom Of Ophiophagus Hannah Length = 151 | Back alignment and structure |
| >pdb|1GH4|A Chain A, Structure Of The Triple Mutant (K56m, K120m, K121m) Of Phospholipase A2 Length = 123 | Back alignment and structure |
| >pdb|1Y6O|A Chain A, Crystal Structure Of Disulfide Engineered Porcine Pancreatic Phospholipase A2 To Group-X Isozyme In Complex With Inhibitor Mj33 And Phosphate Ions Length = 131 | Back alignment and structure |
| >pdb|1MKS|A Chain A, Carboxylic Ester Hydrolase, Trigonal Form Of The Triple Mutant Length = 123 | Back alignment and structure |
| >pdb|1FE5|A Chain A, Sequence And Crystal Structure Of A Basic Phospholipase A2 From Common Krait (Bungarus Caeruleus) At 2.4 Resolution: Identification And Characterization Of Its Pharmacological Sites Length = 118 | Back alignment and structure |
| >pdb|1BPQ|A Chain A, Phospholipase A2 Engineering. X-Ray Structural And Functional Evidence For The Interaction Of Lysine-56 With Substrates Length = 123 | Back alignment and structure |
| >pdb|1IRB|A Chain A, Carboxylic Ester Hydrolase Length = 123 | Back alignment and structure |
| >pdb|2BCH|A Chain A, A Possible Of Second Calcium Ion In Interfacial Binding: Atomic And Medium Resolution Crystal Structures Of The Quadruple Mutant Of Phospholipase A2 Length = 123 | Back alignment and structure |
| >pdb|1C74|A Chain A, Structure Of The Double Mutant (K53,56m) Of Phospholipase A2 Length = 123 | Back alignment and structure |
| >pdb|2ZP3|A Chain A, Carboxylic Ester Hydrolase, Single Mutant D49n Of Bovine Pancreatic Pla2 Enzyme Length = 123 | Back alignment and structure |
| >pdb|1CEH|A Chain A, Structure And Function Of The Catalytic Site Mutant Asp99asn Of Phospholipase A2: Absence Of Conserved Structural Water Length = 123 | Back alignment and structure |
| >pdb|1VL9|A Chain A, Atomic Resolution (0.97a) Structure Of The Triple Mutant (K53,56,121m) Of Bovine Pancreatic Phospholipase A2 Length = 123 | Back alignment and structure |
| >pdb|1O2E|A Chain A, Structure Of The Triple Mutant (K53,56,120m) + Anisic Acid Complex Of Phospholipase A2 Length = 123 | Back alignment and structure |
| >pdb|1G2X|A Chain A, Sequence Induced Trimerization Of Krait Pla2: Crystal Structure Of The Trimeric Form Of Krait Pla2 Length = 118 | Back alignment and structure |
| >pdb|1KVX|A Chain A, Carboxylic Ester Hydrolase, Single Mutant D99a Of Bovine Pancreatic Pla2, 1.9 A Orthorhombic Form Length = 123 | Back alignment and structure |
| >pdb|1KVY|A Chain A, Carboxylic Ester Hydrolase, Single Mutant D49e Coordinated To Calcium Length = 123 | Back alignment and structure |
| >pdb|2ZP5|A Chain A, Carboxylic Ester Hydrolase, Single Mutant D49k Of Bovine Pancreatic Pla2 Enzyme Length = 123 | Back alignment and structure |
| >pdb|1KVW|A Chain A, Carboxylic Ester Hydrolase, Single Mutant H48q Of Bovine Pancreatic Pla2 Enzyme Length = 123 | Back alignment and structure |
| >pdb|1BVM|A Chain A, Solution Nmr Structure Of Bovine Pancreatic Phospholipase A2, 20 Structures Length = 123 | Back alignment and structure |
| >pdb|3BP2|A Chain A, Role Of The N-Terminus In The Interaction Of Pancreatic Phospholipase A2 With Aggregated Substrates. Properties And Crystal Structure Of Transaminated Phospholipase A2 Length = 123 | Back alignment and structure |
| >pdb|1BJJ|A Chain A, Agkistrodotoxin, A Phospholipase A2-Type Presynaptic Neurotoxin From Agkistrodon Halys Pallas Length = 122 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 157 | |||
| 1g0z_A | 118 | Phospholipase A2; toxin; 2.18A {Bungarus caeruleus | 2e-13 | |
| 1n28_B | 124 | Phospholipase A2, membrane associated; hydrolase; | 3e-12 | |
| 1le6_A | 123 | Group X secretory phospholipase A2; human phosphat | 5e-12 | |
| 3jql_A | 119 | Phospholipase A2 isoform 3; phospholipase A2, hexa | 6e-12 | |
| 1oz6_A | 120 | Phospholipase A2; enzyme, PLA2, hydrolase; 2.60A { | 9e-12 | |
| 1vip_A | 121 | Phospholipase A2; hydrolase, anticoagulant; 2.20A | 1e-11 | |
| 2g58_A | 121 | Phospholipase A2 VRV-PL-VIIIA; phospholipase A2, d | 2e-11 | |
| 1p7o_A | 124 | Phospholipase A2, mipla4; pancreatic loop, HYDR; 2 | 2e-11 | |
| 3dih_A | 122 | Phospholipase A2 homolog, ammodytin L; phospholipa | 2e-11 | |
| 1mc2_A | 122 | Acutohaemonlysin, phospholipase A2; YS49-phospholi | 2e-11 | |
| 2aoz_A | 121 | Myotoxin II, phospholipase A2 homolog; X-RAY diffr | 3e-11 | |
| 1jlt_A | 122 | Phospholipase A2 inhibitor; heterodimer complex, h | 4e-11 | |
| 1jia_A | 122 | Phospholipase A2; agkistrodon haLys pallas; 2.13A | 5e-11 | |
| 1gp7_A | 151 | Phospholipase A2; snake venom, KING cobra, cardiot | 1e-10 | |
| 3r0l_D | 122 | Phospholipase A2 CB; crotoxin, presynaptic neuroto | 1e-10 | |
| 1zlb_A | 122 | Hypotensive phospholipase A2; Asp49-PLA2, toxin, s | 1e-10 | |
| 1bun_A | 120 | BETA2-bungarotoxin; hydrolase, presynaptic neuroto | 2e-10 | |
| 1m8r_A | 124 | Phospholipase A2; phopholipase A2-metal cation com | 2e-10 | |
| 2h4c_B | 122 | Phospholipase A2-II; non-inhibitor acidic PLA2, ba | 3e-10 | |
| 1gmz_A | 122 | Phospholipase A2; hydrolase, neurotoxic; 2.4A {Bot | 4e-10 | |
| 3vbz_A | 118 | Phospholipase A2 homolog, taipoxin beta chain; pho | 5e-10 | |
| 4e4c_A | 119 | Phospholipase A2; hydrolase; HET: MES; 1.80A {Note | 8e-10 | |
| 1jlt_B | 122 | Phospholipase A2, vipoxin; heterodimer complex, hy | 1e-09 | |
| 2qhd_A | 122 | Phospholipase A2; beta sheet, three helices, prote | 1e-09 | |
| 1g4i_A | 123 | Phospholipase A2; lipid degradation, hydrolase; 0. | 2e-09 | |
| 1m8t_A | 119 | Phospholipase A2; twinned crystal, alpha, beta, hy | 2e-08 |
| >1g0z_A Phospholipase A2; toxin; 2.18A {Bungarus caeruleus} SCOP: a.133.1.2 PDB: 1u4j_A* 1g2x_A 2osn_A 1dpy_A 1fe5_A 1tc8_A* 1po8_A* Length = 118 | Back alignment and structure |
|---|
Score = 61.9 bits (150), Expect = 2e-13
Identities = 34/128 (26%), Positives = 49/128 (38%), Gaps = 29/128 (22%)
Query: 6 SAVQLYSMVSCSTGCDPLSYKGYGCYCGFLGSGYPVDPIDRTSQLNMARDHDSGHEIYII 65
+ Q +M+ C+ SY GYGCYCG+ GSG PVD +DR HD +
Sbjct: 1 NLKQFKNMIQCAGTRTWTSYIGYGCYCGYGGSGTPVDELDRCCY-----THDHCYN---- 51
Query: 66 FIYSGVVSYTTGAIQGPTVLSFSNIS-SPTCGPASEDGPYVVSKASKRGKSCSHRLCECD 124
+ G S++ + TC S SC+ +C+CD
Sbjct: 52 -----KAANIPGCNPLIKTYSYTCTKPNITCNDTS--------------DSCARFICDCD 92
Query: 125 RRFSECLR 132
R + C
Sbjct: 93 RTAAICFA 100
|
| >1n28_B Phospholipase A2, membrane associated; hydrolase; 1.50A {Homo sapiens} SCOP: a.133.1.2 PDB: 1n29_A 1kvo_A* 1ayp_A 1db4_A* 1db5_A* 1dcy_A* 1j1a_A* 1bbc_A* 1kqu_A* 1pod_A 1poe_A* Length = 124 | Back alignment and structure |
|---|
| >1le6_A Group X secretory phospholipase A2; human phosphatidylcholine 2-acylhydrolase GX, GX SPLA2, SPLA2-X; 1.97A {Homo sapiens} SCOP: a.133.1.2 PDB: 1le7_A Length = 123 | Back alignment and structure |
|---|
| >3jql_A Phospholipase A2 isoform 3; phospholipase A2, hexapeptide, hydrolase, calcium, disulfide bond, lipid degradation, metal-binding, secreted; 1.20A {Naja sagittifera} PDB: 1mf4_A 3jq5_A 1ln8_A 3jti_A 3nju_A* 3osh_A* 3q4y_A 1t37_A 1zm6_A 3gci_A 1yxl_A 1oxr_A 1td7_A* 1sz8_A 1a3d_A 1a3f_A 1psh_A 2osh_A 1poa_A 1pob_A* ... Length = 119 | Back alignment and structure |
|---|
| >1oz6_A Phospholipase A2; enzyme, PLA2, hydrolase; 2.60A {Echis carinatus} SCOP: a.133.1.2 Length = 120 | Back alignment and structure |
|---|
| >1vip_A Phospholipase A2; hydrolase, anticoagulant; 2.20A {Daboia russellii russellii} SCOP: a.133.1.2 Length = 121 | Back alignment and structure |
|---|
| >2g58_A Phospholipase A2 VRV-PL-VIIIA; phospholipase A2, diars, hydrolase-hydrolase inhibitor compl; HET: PHQ; 0.98A {Daboia russellii pulchella} SCOP: a.133.1.2 PDB: 1cl5_A 1fb2_A* 1jq8_A 1jq9_A 1kpm_A* 1oxl_A* 1fv0_A* 1q7a_A 1skg_A* 1sv3_A* 1sv9_A* 1sxk_A* 1tdv_A 1tg1_A* 1tg4_A 1th6_A* 1sqz_A 1tjq_A* 1tk4_A 1tp2_A* ... Length = 121 | Back alignment and structure |
|---|
| >1p7o_A Phospholipase A2, mipla4; pancreatic loop, HYDR; 2.30A {Micropechis ikaheka} SCOP: a.133.1.2 PDB: 1pwo_A 1ozy_A Length = 124 | Back alignment and structure |
|---|
| >3dih_A Phospholipase A2 homolog, ammodytin L; phospholipase A2 fold, myotoxin, secreted, toxin; 2.60A {Vipera ammodytes ammodytes} PDB: 3ux7_A Length = 122 | Back alignment and structure |
|---|
| >1mc2_A Acutohaemonlysin, phospholipase A2; YS49-phospholipase A2, snake venom, toxin; 0.85A {Deinagkistrodon acutus} SCOP: a.133.1.2 PDB: 1mg6_A 1pa0_A 3i03_A* 3hzd_A 3hzw_A* 3cxi_A* 3i3h_A 3i3i_A 1pc9_A 2q2j_A 3cyl_A* 1qll_A* 1xxs_A* 3qnl_A* 2ok9_A* 3iq3_A* 2h8i_A* 3mlm_A* 1y4l_A* 1clp_A* ... Length = 122 | Back alignment and structure |
|---|
| >2aoz_A Myotoxin II, phospholipase A2 homolog; X-RAY diffration, myotoxicity, atropoides toxin; 2.08A {Atropoides nummifer} Length = 121 | Back alignment and structure |
|---|
| >1jlt_A Phospholipase A2 inhibitor; heterodimer complex, hydrolase, PLA2-activity; 1.40A {Vipera ammodytes ammodytes} SCOP: a.133.1.2 PDB: 1vpi_A 1aok_A 1q5t_A 1oqs_A 2h4c_A Length = 122 | Back alignment and structure |
|---|
| >1jia_A Phospholipase A2; agkistrodon haLys pallas; 2.13A {Gloydius halys} SCOP: a.133.1.2 PDB: 1b4w_A 1c1j_A* Length = 122 | Back alignment and structure |
|---|
| >1gp7_A Phospholipase A2; snake venom, KING cobra, cardiotoxic activity, myotoxic activity, pancreatic loop, hydrolase, lipid degradation, calcium; 2.6A {Ophiophagus hannah} SCOP: a.133.1.2 Length = 151 | Back alignment and structure |
|---|
| >3r0l_D Phospholipase A2 CB; crotoxin, presynaptic neurotoxin, snake venom, phospholipase heterodimer interface, hydrolase; 1.35A {Crotalus durissus terrificus} PDB: 2qog_B 2qog_A 1bjj_A 1a2a_A Length = 122 | Back alignment and structure |
|---|
| >1zlb_A Hypotensive phospholipase A2; Asp49-PLA2, toxin, snake venom, hydrolase; 0.97A {Bothrops jararacussu} SCOP: a.133.1.2 PDB: 1umv_X 1zl7_A 1z76_A* 1u73_A* 1vap_A 3r0l_A Length = 122 | Back alignment and structure |
|---|
| >1bun_A BETA2-bungarotoxin; hydrolase, presynaptic neurotoxin; 2.45A {Bungarus multicinctus} SCOP: a.133.1.2 Length = 120 | Back alignment and structure |
|---|
| >1m8r_A Phospholipase A2; phopholipase A2-metal cation complex, three alpha, two beta, hydrolase; 1.90A {Gloydius halys} SCOP: a.133.1.2 PDB: 1m8s_A 1bk9_A* 1psj_A 1ijl_A 1pp2_R Length = 124 | Back alignment and structure |
|---|
| >2h4c_B Phospholipase A2-II; non-inhibitor acidic PLA2, basic PLA2, heterodimer, hydrolase; 2.60A {Daboia russellii siamensis} Length = 122 | Back alignment and structure |
|---|
| >1gmz_A Phospholipase A2; hydrolase, neurotoxic; 2.4A {Bothrops pirajai} SCOP: a.133.1.2 Length = 122 | Back alignment and structure |
|---|
| >3vbz_A Phospholipase A2 homolog, taipoxin beta chain; phospholipase A2 fold, PLA2 fold, neurotoxin, binding; 1.76A {Oxyuranus scutellatus scutellatus} PDB: 3vc0_A Length = 118 | Back alignment and structure |
|---|
| >4e4c_A Phospholipase A2; hydrolase; HET: MES; 1.80A {Notechis scutatus scutatus} PDB: 1ae7_A* 2not_A Length = 119 | Back alignment and structure |
|---|
| >1jlt_B Phospholipase A2, vipoxin; heterodimer complex, hydrolase, PLA2-activity; 1.40A {Vipera ammodytes ammodytes} SCOP: a.133.1.2 PDB: 1rgb_A* 2i0u_E* 1aok_B 1oqs_B Length = 122 | Back alignment and structure |
|---|
| >2qhd_A Phospholipase A2; beta sheet, three helices, protein-ligand complex, hydrolase; HET: DAO; 1.95A {Echis carinatus} PDB: 2qhe_A 3bjw_A* Length = 122 | Back alignment and structure |
|---|
| >1g4i_A Phospholipase A2; lipid degradation, hydrolase; 0.97A {Bos taurus} SCOP: a.133.1.2 PDB: 1bvm_A 1fdk_A* 1bp2_A 1mkt_A 1mkv_A* 1une_A 2bpp_A 4bp2_A 2bp2_A 1kvy_A 1bpq_A 2zp3_A 1ceh_A 3bp2_A 2zp5_A 1kvx_A 1kvw_A 2zp4_A 1irb_A 2bax_A* ... Length = 123 | Back alignment and structure |
|---|
| >1m8t_A Phospholipase A2; twinned crystal, alpha, beta, hydrolase; 2.10A {Ophiophagus hannah} SCOP: a.133.1.2 Length = 119 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 157 | |||
| 1le6_A | 123 | Group X secretory phospholipase A2; human phosphat | 100.0 | |
| 3jql_A | 119 | Phospholipase A2 isoform 3; phospholipase A2, hexa | 100.0 | |
| 4e4c_A | 119 | Phospholipase A2; hydrolase; HET: MES; 1.80A {Note | 100.0 | |
| 3vbz_A | 118 | Phospholipase A2 homolog, taipoxin beta chain; pho | 100.0 | |
| 1g0z_A | 118 | Phospholipase A2; toxin; 2.18A {Bungarus caeruleus | 100.0 | |
| 3u8i_A | 124 | Phospholipase A2, membrane associated; secreted ph | 100.0 | |
| 3r0l_D | 122 | Phospholipase A2 CB; crotoxin, presynaptic neuroto | 100.0 | |
| 1p7o_A | 124 | Phospholipase A2, mipla4; pancreatic loop, HYDR; 2 | 100.0 | |
| 1m8t_A | 119 | Phospholipase A2; twinned crystal, alpha, beta, hy | 100.0 | |
| 1gp7_A | 151 | Phospholipase A2; snake venom, KING cobra, cardiot | 100.0 | |
| 3dih_A | 122 | Phospholipase A2 homolog, ammodytin L; phospholipa | 100.0 | |
| 4hg9_A | 122 | Basic phospholipase A2 B; alpha-helix, glycerophos | 100.0 | |
| 1jlt_A | 122 | Phospholipase A2 inhibitor; heterodimer complex, h | 100.0 | |
| 2g58_A | 121 | Phospholipase A2 VRV-PL-VIIIA; phospholipase A2, d | 100.0 | |
| 1g4i_A | 123 | Phospholipase A2; lipid degradation, hydrolase; 0. | 100.0 | |
| 2aoz_A | 121 | Myotoxin II, phospholipase A2 homolog; X-RAY diffr | 100.0 | |
| 2qhd_A | 122 | Phospholipase A2; beta sheet, three helices, prote | 100.0 | |
| 1oz6_A | 120 | Phospholipase A2; enzyme, PLA2, hydrolase; 2.60A { | 100.0 | |
| 4h0q_A | 121 | Phospholipase A2, acid 5; alpha-helix, glycerophos | 100.0 | |
| 2h4c_B | 122 | Phospholipase A2-II; non-inhibitor acidic PLA2, ba | 100.0 | |
| 1bk9_A | 124 | Phospholipase A2; hydrolase, platelet aggregation | 100.0 | |
| 1vip_A | 121 | Phospholipase A2; hydrolase, anticoagulant; 2.20A | 100.0 | |
| 1bun_A | 120 | BETA2-bungarotoxin; hydrolase, presynaptic neuroto | 100.0 | |
| 1jlt_B | 122 | Phospholipase A2, vipoxin; heterodimer complex, hy | 100.0 | |
| 1zlb_A | 122 | Hypotensive phospholipase A2; Asp49-PLA2, toxin, s | 100.0 | |
| 1gmz_A | 122 | Phospholipase A2; hydrolase, neurotoxic; 2.4A {Bot | 100.0 | |
| 1mc2_A | 122 | Acutohaemonlysin, phospholipase A2; YS49-phospholi | 100.0 | |
| 4h0s_A | 137 | Svpla2 homolog, basic phospholipase A2 homolog CTS | 100.0 | |
| 2wg7_A | 130 | PLA2, putative phospholipase A2; hydrolase, secret | 99.75 | |
| 3r0l_B | 35 | Crotoxin chain B; crotoxin, presynaptic neurotoxin | 98.64 | |
| 1poc_A | 134 | Phospholipase A2; hydrolase; HET: GEL; 2.00A {Apis | 98.05 |
| >1le6_A Group X secretory phospholipase A2; human phosphatidylcholine 2-acylhydrolase GX, GX SPLA2, SPLA2-X; 1.97A {Homo sapiens} SCOP: a.133.1.2 PDB: 1le7_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.6e-39 Score=247.09 Aligned_cols=107 Identities=28% Similarity=0.515 Sum_probs=99.6
Q ss_pred cHHHHHHHHhhhcCCCcccccCCccccCCCCCCCCcCccCCccccccccchhhHHhhhhhcccCCc-ceeeEEeecCCcc
Q psy12202 6 SAVQLYSMVSCSTGCDPLSYKGYGCYCGFLGSGYPVDPIDRTSQLNMARDHDSGHEIYIIFIYSGV-VSYTTGAIQGPTV 84 (157)
Q Consensus 6 ~l~qf~~Mi~c~tg~~~l~Y~~YGCyCg~gG~G~PVD~iDrcC~~~~~~~Hd~CY~~~~~~~c~~~-~~Y~~~~~~~~~~ 84 (157)
+|+||++||++++++++++|++||||||+||+|+|||+|||||+. ||.||+++....|.|+ +.|+|++.++
T Consensus 1 ~l~qf~~MI~~~~~~~~~~Y~~YGCyCg~gG~G~PvD~~DrcC~~-----hd~CY~~~~~~~C~p~~~~Y~~~~~~~--- 72 (123)
T 1le6_A 1 GILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHG-----HDCCYTRAEEAGCSPKTERYSWQCVNQ--- 72 (123)
T ss_dssp CHHHHHHHHHHHSSSCGGGGSSBTTTBSSSCCSCCCSHHHHHHHH-----HHHHHHHHHHTTCCTTTCCCCEEEETT---
T ss_pred CHHHHHHHHHHccCCCHHHHcccCCCcCCCCCCCcCCcHhHHHHH-----HHHHHHHHhhCCcccccCceEEEEECC---
Confidence 589999999999999999999999999999999999999999999 9999999987778887 8999999887
Q ss_pred cccCCCCCceeCCCCCCCCceeeccCCCCChhhhhhchhhHHHHHHhccCCCCCCcc
Q psy12202 85 LSFSNISSPTCGPASEDGPYVVSKASKRGKSCSHRLCECDRRFSECLRPYSCPKYKA 141 (157)
Q Consensus 85 ~s~~~~~~i~C~~~~~~~~~~~~~~~~~~~~C~~~lCeCDr~~A~C~~~~~~~~~~~ 141 (157)
.|+|. +..++|+++||||||+||+||++++|+.+..
T Consensus 73 -------~i~C~--------------~~~~~C~~~lCeCDk~~A~c~a~~~yn~~~~ 108 (123)
T 1le6_A 73 -------SVLCG--------------PAENKCQELLCKCDQEIANCLAQTEYNLKYL 108 (123)
T ss_dssp -------EEEEC--------------CCSSHHHHHHHHHHHHHHHHHHTCCCCGGGB
T ss_pred -------cceEC--------------CCCChHHHHHccCcHHHHHHHHHCccCHHHc
Confidence 89994 5779999999999999999999999988643
|
| >3jql_A Phospholipase A2 isoform 3; phospholipase A2, hexapeptide, hydrolase, calcium, disulfide bond, lipid degradation, metal-binding, secreted; 1.20A {Naja sagittifera} SCOP: a.133.1.2 PDB: 1mf4_A 3jq5_A 1ln8_A 3jti_A 3nju_A* 3osh_A* 3q4y_A 1t37_A 1zm6_A 3gci_A 1yxl_A 1oxr_A 1td7_A* 1sz8_A 1a3d_A 1a3f_A 1psh_A 2osh_A 1poa_A 1pob_A* ... | Back alignment and structure |
|---|
| >4e4c_A Phospholipase A2; hydrolase; HET: MES; 1.80A {Notechis scutatus scutatus} PDB: 1ae7_A* 2not_A | Back alignment and structure |
|---|
| >3vbz_A Phospholipase A2 homolog, taipoxin beta chain; phospholipase A2 fold, PLA2 fold, neurotoxin, binding; 1.76A {Oxyuranus scutellatus scutellatus} PDB: 3vc0_A | Back alignment and structure |
|---|
| >1g0z_A Phospholipase A2; toxin; 2.18A {Bungarus caeruleus} SCOP: a.133.1.2 PDB: 1u4j_A* 1g2x_A 2osn_A 1dpy_A 1fe5_A 1tc8_A* 1po8_A* | Back alignment and structure |
|---|
| >3u8i_A Phospholipase A2, membrane associated; secreted phospholipase A2, hydrolase; HET: OLD; 1.10A {Homo sapiens} PDB: 3u8d_A* 1ayp_A 1db4_A* 1db5_A* 1dcy_A* 1j1a_A* 1bbc_A* 1kqu_A* 1pod_A 1poe_A* 3u8b_A 1kvo_A* 3u8h_A* 1n28_B 1n29_A | Back alignment and structure |
|---|
| >3r0l_D Phospholipase A2 CB; crotoxin, presynaptic neurotoxin, snake venom, phospholipase heterodimer interface, hydrolase; 1.35A {Crotalus durissus terrificus} SCOP: a.133.1.2 PDB: 2qog_B 2qog_A 1bjj_A 1a2a_A | Back alignment and structure |
|---|
| >1p7o_A Phospholipase A2, mipla4; pancreatic loop, HYDR; 2.30A {Micropechis ikaheka} SCOP: a.133.1.2 PDB: 1pwo_A 1ozy_A | Back alignment and structure |
|---|
| >1m8t_A Phospholipase A2; twinned crystal, alpha, beta, hydrolase; 2.10A {Ophiophagus hannah} SCOP: a.133.1.2 | Back alignment and structure |
|---|
| >1gp7_A Phospholipase A2; snake venom, KING cobra, cardiotoxic activity, myotoxic activity, pancreatic loop, hydrolase, lipid degradation, calcium; 2.6A {Ophiophagus hannah} SCOP: a.133.1.2 | Back alignment and structure |
|---|
| >3dih_A Phospholipase A2 homolog, ammodytin L; phospholipase A2 fold, myotoxin, secreted, toxin; 2.60A {Vipera ammodytes ammodytes} SCOP: a.133.1.2 PDB: 3ux7_A | Back alignment and structure |
|---|
| >4hg9_A Basic phospholipase A2 B; alpha-helix, glycerophospholipid, venom gland, hydrolase; HET: CIT G3P; 1.60A {Gloydius halys} PDB: 1jia_A 1b4w_A 1c1j_A* | Back alignment and structure |
|---|
| >1jlt_A Phospholipase A2 inhibitor; heterodimer complex, hydrolase, PLA2-activity; 1.40A {Vipera ammodytes ammodytes} SCOP: a.133.1.2 PDB: 1vpi_A 1aok_A 1q5t_A 1oqs_A 2h4c_A | Back alignment and structure |
|---|
| >2g58_A Phospholipase A2 VRV-PL-VIIIA; phospholipase A2, diars, hydrolase-hydrolase inhibitor compl; HET: PHQ; 0.98A {Daboia russellii pulchella} SCOP: a.133.1.2 PDB: 1cl5_A 1fb2_A* 1jq8_A 1jq9_A 1kpm_A* 1oxl_A* 1fv0_A* 1q7a_A 1skg_A* 1sv3_A* 1sv9_A* 1sxk_A* 1tdv_A 1tg1_A* 1tg4_A 1th6_A* 1sqz_A 1tjq_A* 1tk4_A 1tp2_A* ... | Back alignment and structure |
|---|
| >1g4i_A Phospholipase A2; lipid degradation, hydrolase; 0.97A {Bos taurus} SCOP: a.133.1.2 PDB: 1bvm_A 1fdk_A* 1bp2_A 1mkt_A 1mkv_A* 1une_A 2bpp_A 4bp2_A 2bp2_A 1kvy_A 1bpq_A 2zp3_A 1ceh_A 3bp2_A 2zp5_A 1kvx_A 1kvw_A 2zp4_A 1irb_A 2bax_A* ... | Back alignment and structure |
|---|
| >2aoz_A Myotoxin II, phospholipase A2 homolog; X-RAY diffration, myotoxicity, atropoides toxin; 2.08A {Atropoides nummifer} | Back alignment and structure |
|---|
| >2qhd_A Phospholipase A2; beta sheet, three helices, protein-ligand complex, hydrolase; HET: DAO; 1.95A {Echis carinatus} PDB: 2qhe_A 3bjw_A* | Back alignment and structure |
|---|
| >1oz6_A Phospholipase A2; enzyme, PLA2, hydrolase; 2.60A {Echis carinatus} SCOP: a.133.1.2 | Back alignment and structure |
|---|
| >4h0q_A Phospholipase A2, acid 5; alpha-helix, glycerophospholipid, venom gland, hydrolase; 1.60A {Viridovipera stejnegeri} PDB: 1m8r_A 1m8s_A | Back alignment and structure |
|---|
| >2h4c_B Phospholipase A2-II; non-inhibitor acidic PLA2, basic PLA2, heterodimer, hydrolase; 2.60A {Daboia russellii siamensis} | Back alignment and structure |
|---|
| >1bk9_A Phospholipase A2; hydrolase, platelet aggregation inhibitor, PBPB; HET: PBP; 2.00A {Gloydius halys} SCOP: a.133.1.2 PDB: 1psj_A 1ijl_A 1pp2_R | Back alignment and structure |
|---|
| >1vip_A Phospholipase A2; hydrolase, anticoagulant; 2.20A {Daboia russellii russellii} SCOP: a.133.1.2 | Back alignment and structure |
|---|
| >1bun_A BETA2-bungarotoxin; hydrolase, presynaptic neurotoxin; 2.45A {Bungarus multicinctus} SCOP: a.133.1.2 | Back alignment and structure |
|---|
| >1jlt_B Phospholipase A2, vipoxin; heterodimer complex, hydrolase, PLA2-activity; 1.40A {Vipera ammodytes ammodytes} SCOP: a.133.1.2 PDB: 1rgb_A* 2i0u_E* 1aok_B 1oqs_B | Back alignment and structure |
|---|
| >1zlb_A Hypotensive phospholipase A2; Asp49-PLA2, toxin, snake venom, hydrolase; 0.97A {Bothrops jararacussu} SCOP: a.133.1.2 PDB: 1umv_X 1zl7_A 1z76_A* 1u73_A* 1vap_A 3r0l_A | Back alignment and structure |
|---|
| >1gmz_A Phospholipase A2; hydrolase, neurotoxic; 2.4A {Bothrops pirajai} SCOP: a.133.1.2 | Back alignment and structure |
|---|
| >1mc2_A Acutohaemonlysin, phospholipase A2; YS49-phospholipase A2, snake venom, toxin; 0.85A {Deinagkistrodon acutus} SCOP: a.133.1.2 PDB: 1mg6_A 1pa0_A 3i03_A* 3hzd_A 3hzw_A* 3cxi_A* 3i3h_A 3i3i_A 1pc9_A 2q2j_A 3cyl_A* 1qll_A* 1xxs_A* 3qnl_A* 2ok9_A* 3iq3_A* 2h8i_A* 3mlm_A* 1y4l_A* 1clp_A* ... | Back alignment and structure |
|---|
| >4h0s_A Svpla2 homolog, basic phospholipase A2 homolog CTS-R6; alpha-helix, glycerophospholipid, venom gland, hydrolase; 1.55A {Viridovipera stejnegeri} | Back alignment and structure |
|---|
| >2wg7_A PLA2, putative phospholipase A2; hydrolase, secretory PLA2; 2.00A {Oryza sativa} PDB: 2wg9_A* 2wg8_B 2wg8_A | Back alignment and structure |
|---|
| >3r0l_B Crotoxin chain B; crotoxin, presynaptic neurotoxin, snake venom, phospholipase heterodimer interface, hydrolase; 1.35A {Crotalus durissus terrificus} | Back alignment and structure |
|---|
| >1poc_A Phospholipase A2; hydrolase; HET: GEL; 2.00A {Apis mellifera} SCOP: a.133.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 157 | ||||
| d1le6a_ | 123 | a.133.1.2 (A:) Phospholipase A2 {Human (Homo sapie | 5e-13 | |
| d1sz8a_ | 119 | a.133.1.2 (A:) Snake phospholipase A2 {Andaman cob | 1e-11 | |
| d2g58a1 | 121 | a.133.1.2 (A:1-133) Snake phospholipase A2 {Snake | 2e-11 | |
| d1g0za_ | 118 | a.133.1.2 (A:) Snake phospholipase A2 {Indian krai | 2e-11 | |
| d1n28a_ | 124 | a.133.1.2 (A:) Phospholipase A2 {Human (Homo sapie | 2e-11 | |
| d1jltb_ | 122 | a.133.1.2 (B:) Snake phospholipase A2 {Sand viper | 3e-11 | |
| d1ppaa_ | 121 | a.133.1.2 (A:) Snake phospholipase A2 {Eastern cot | 9e-11 | |
| d1p7oa_ | 124 | a.133.1.2 (A:) Snake phospholipase A2 {Small-eye s | 1e-10 | |
| d1m8ta_ | 119 | a.133.1.2 (A:) Snake phospholipase A2 {King cobra | 1e-10 | |
| d1mc2a_ | 122 | a.133.1.2 (A:) Snake phospholipase A2 {Hundred-pac | 2e-10 | |
| d1oz6a_ | 120 | a.133.1.2 (A:) Snake phospholipase A2 {Saw-scaled | 2e-10 | |
| d1bjja_ | 122 | a.133.1.2 (A:) Snake phospholipase A2 {Snake (Agki | 2e-10 | |
| d1g4ia_ | 123 | a.133.1.2 (A:) Phospholipase A2 {Cow (Bos taurus), | 3e-10 | |
| d1buna_ | 120 | a.133.1.2 (A:) Snake phospholipase A2 {Many-banded | 6e-10 | |
| d1jlta_ | 122 | a.133.1.2 (A:) Snake phospholipase A2 {Sand viper | 9e-10 | |
| d1vipa_ | 121 | a.133.1.2 (A:) Snake phospholipase A2 {Russell's v | 9e-10 | |
| d1gmza_ | 122 | a.133.1.2 (A:) Snake phospholipase A2 {Snake (Both | 9e-10 | |
| d1m8ra_ | 124 | a.133.1.2 (A:) Snake phospholipase A2 {Snake (Agki | 1e-09 | |
| d1jiaa_ | 122 | a.133.1.2 (A:) Snake phospholipase A2 {Snake (Agki | 1e-09 | |
| d1zlba1 | 122 | a.133.1.2 (A:1-122) Snake phospholipase A2 {Jarara | 2e-09 | |
| d1ae7a_ | 119 | a.133.1.2 (A:) Snake phospholipase A2 {Mainland ti | 6e-08 |
| >d1le6a_ a.133.1.2 (A:) Phospholipase A2 {Human (Homo sapiens), SPLA2 [TaxId: 9606]} Length = 123 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Phospholipase A2, PLA2 superfamily: Phospholipase A2, PLA2 family: Vertebrate phospholipase A2 domain: Phospholipase A2 species: Human (Homo sapiens), SPLA2 [TaxId: 9606]
Score = 60.0 bits (145), Expect = 5e-13
Identities = 27/128 (21%), Positives = 39/128 (30%), Gaps = 28/128 (21%)
Query: 8 VQLYSMVSCSTGCDPLSYKGYGCYCGFLGSGYPVDPIDRTSQLNMARDHDSGHEIYIIFI 67
++L V C P++Y YGC+CG G G P D ID + +
Sbjct: 3 LELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKT 62
Query: 68 YSGVVSYTTGAIQGPTVLSFSNISSPTCGPASEDGPYVVSKASKRGKSCSHRLCECDRRF 127
++ CGPA C LC+CD+
Sbjct: 63 ERYSWQCVNQSV--------------LCGPAE--------------NKCQELLCKCDQEI 94
Query: 128 SECLRPYS 135
+ CL
Sbjct: 95 ANCLAQTE 102
|
| >d1sz8a_ a.133.1.2 (A:) Snake phospholipase A2 {Andaman cobra (Naja sagittifera), acidic isoform 1 [TaxId: 195058]} Length = 119 | Back information, alignment and structure |
|---|
| >d2g58a1 a.133.1.2 (A:1-133) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]} Length = 121 | Back information, alignment and structure |
|---|
| >d1g0za_ a.133.1.2 (A:) Snake phospholipase A2 {Indian krait (Bungarus caeruleus), different isoforms [TaxId: 132961]} Length = 118 | Back information, alignment and structure |
|---|
| >d1n28a_ a.133.1.2 (A:) Phospholipase A2 {Human (Homo sapiens), synovial fluid [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1jltb_ a.133.1.2 (B:) Snake phospholipase A2 {Sand viper (Vipera ammodytes meridionalis), vipoxin catalytic subunit [TaxId: 8704]} Length = 122 | Back information, alignment and structure |
|---|
| >d1ppaa_ a.133.1.2 (A:) Snake phospholipase A2 {Eastern cottonmouth snake (Agkistrodon piscivorus piscivorus) [TaxId: 8716]} Length = 121 | Back information, alignment and structure |
|---|
| >d1p7oa_ a.133.1.2 (A:) Snake phospholipase A2 {Small-eye snake (Micropechis ikaheka), different isoforms [TaxId: 66188]} Length = 124 | Back information, alignment and structure |
|---|
| >d1m8ta_ a.133.1.2 (A:) Snake phospholipase A2 {King cobra (Ophiophagus hannah), an acidic isoform [TaxId: 8665]} Length = 119 | Back information, alignment and structure |
|---|
| >d1mc2a_ a.133.1.2 (A:) Snake phospholipase A2 {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Length = 122 | Back information, alignment and structure |
|---|
| >d1oz6a_ a.133.1.2 (A:) Snake phospholipase A2 {Saw-scaled viper (Echis carinatus) [TaxId: 40353]} Length = 120 | Back information, alignment and structure |
|---|
| >d1bjja_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Agkistrodon halys) [TaxId: 8714]} Length = 122 | Back information, alignment and structure |
|---|
| >d1g4ia_ a.133.1.2 (A:) Phospholipase A2 {Cow (Bos taurus), pancreas [TaxId: 9913]} Length = 123 | Back information, alignment and structure |
|---|
| >d1buna_ a.133.1.2 (A:) Snake phospholipase A2 {Many-banded krait (Bungarus multicinctus), beta2-bungarotoxin [TaxId: 8616]} Length = 120 | Back information, alignment and structure |
|---|
| >d1jlta_ a.133.1.2 (A:) Snake phospholipase A2 {Sand viper (Vipera ammodytes meridionalis), vipoxin inhibitor [TaxId: 8704]} Length = 122 | Back information, alignment and structure |
|---|
| >d1vipa_ a.133.1.2 (A:) Snake phospholipase A2 {Russell's viper (Vipera russelli) [TaxId: 8707]} Length = 121 | Back information, alignment and structure |
|---|
| >d1gmza_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Bothrops pirajai), piratoxin III [TaxId: 113192]} Length = 122 | Back information, alignment and structure |
|---|
| >d1m8ra_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Agkistrodon halys) [TaxId: 8714]} Length = 124 | Back information, alignment and structure |
|---|
| >d1jiaa_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Agkistrodon halys) [TaxId: 8714]} Length = 122 | Back information, alignment and structure |
|---|
| >d1zlba1 a.133.1.2 (A:1-122) Snake phospholipase A2 {Jararacussu (Bothrops jararacussu) [TaxId: 8726]} Length = 122 | Back information, alignment and structure |
|---|
| >d1ae7a_ a.133.1.2 (A:) Snake phospholipase A2 {Mainland tiger snake (Notechis scutatus scutatus), notexin [TaxId: 8663]} Length = 119 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 157 | |||
| d1le6a_ | 123 | Phospholipase A2 {Human (Homo sapiens), SPLA2 [Tax | 100.0 | |
| d1g0za_ | 118 | Snake phospholipase A2 {Indian krait (Bungarus cae | 100.0 | |
| d1ae7a_ | 119 | Snake phospholipase A2 {Mainland tiger snake (Note | 100.0 | |
| d1buna_ | 120 | Snake phospholipase A2 {Many-banded krait (Bungaru | 100.0 | |
| d1n28a_ | 124 | Phospholipase A2 {Human (Homo sapiens), synovial f | 100.0 | |
| d1sz8a_ | 119 | Snake phospholipase A2 {Andaman cobra (Naja sagitt | 100.0 | |
| d1m8ta_ | 119 | Snake phospholipase A2 {King cobra (Ophiophagus ha | 100.0 | |
| d1p7oa_ | 124 | Snake phospholipase A2 {Small-eye snake (Micropech | 100.0 | |
| d1g4ia_ | 123 | Phospholipase A2 {Cow (Bos taurus), pancreas [TaxI | 100.0 | |
| d2g58a1 | 121 | Snake phospholipase A2 {Snake (Daboia russellii pu | 100.0 | |
| d1gmza_ | 122 | Snake phospholipase A2 {Snake (Bothrops pirajai), | 100.0 | |
| d1zlba1 | 122 | Snake phospholipase A2 {Jararacussu (Bothrops jara | 100.0 | |
| d1oz6a_ | 120 | Snake phospholipase A2 {Saw-scaled viper (Echis ca | 100.0 | |
| d1jltb_ | 122 | Snake phospholipase A2 {Sand viper (Vipera ammodyt | 100.0 | |
| d1m8ra_ | 124 | Snake phospholipase A2 {Snake (Agkistrodon halys) | 100.0 | |
| d1jiaa_ | 122 | Snake phospholipase A2 {Snake (Agkistrodon halys) | 100.0 | |
| d1jlta_ | 122 | Snake phospholipase A2 {Sand viper (Vipera ammodyt | 100.0 | |
| d1vipa_ | 121 | Snake phospholipase A2 {Russell's viper (Vipera ru | 100.0 | |
| d1mc2a_ | 122 | Snake phospholipase A2 {Hundred-pace snake (Agkist | 100.0 | |
| d1ppaa_ | 121 | Snake phospholipase A2 {Eastern cottonmouth snake | 100.0 | |
| d1bjja_ | 122 | Snake phospholipase A2 {Snake (Agkistrodon halys) | 100.0 | |
| d1poca_ | 134 | Phospholipase A2 {European honeybee (Apis mellifer | 96.49 |
| >d1le6a_ a.133.1.2 (A:) Phospholipase A2 {Human (Homo sapiens), SPLA2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Phospholipase A2, PLA2 superfamily: Phospholipase A2, PLA2 family: Vertebrate phospholipase A2 domain: Phospholipase A2 species: Human (Homo sapiens), SPLA2 [TaxId: 9606]
Probab=100.00 E-value=1.3e-40 Score=251.60 Aligned_cols=108 Identities=28% Similarity=0.510 Sum_probs=99.9
Q ss_pred cHHHHHHHHhhhcCCCcccccCCccccCCCCCCCCcCccCCccccccccchhhHHhhhhhcccCCc-ceeeEEeecCCcc
Q psy12202 6 SAVQLYSMVSCSTGCDPLSYKGYGCYCGFLGSGYPVDPIDRTSQLNMARDHDSGHEIYIIFIYSGV-VSYTTGAIQGPTV 84 (157)
Q Consensus 6 ~l~qf~~Mi~c~tg~~~l~Y~~YGCyCg~gG~G~PVD~iDrcC~~~~~~~Hd~CY~~~~~~~c~~~-~~Y~~~~~~~~~~ 84 (157)
.||||++||+|+||++|++|++||||||+||+|.|||+|||||+. ||.||+.+....|.++ .+|+|.+.++
T Consensus 1 gllq~~~mi~c~tg~~~~~Y~~YGCyCG~gG~G~PvD~~D~CC~~-----HD~CY~~~~~~~c~~~~~~Y~~~c~~~--- 72 (123)
T d1le6a_ 1 GILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHG-----HDCCYTRAEEAGCSPKTERYSWQCVNQ--- 72 (123)
T ss_dssp CHHHHHHHHHHHSSSCGGGGSSBTTTBSSSCCSCCCSHHHHHHHH-----HHHHHHHHHHTTCCTTTCCCCEEEETT---
T ss_pred ChhHHHHHHHHHcCCCHHHHCCcCcCCCCCCCCCCchhhHHHHhh-----chHHHHHHHhcCccCCccceeEEEECC---
Confidence 389999999999999999999999999999999999999999999 9999999987778887 8999999888
Q ss_pred cccCCCCCceeCCCCCCCCceeeccCCCCChhhhhhchhhHHHHHHhccCCCCCCccc
Q psy12202 85 LSFSNISSPTCGPASEDGPYVVSKASKRGKSCSHRLCECDRRFSECLRPYSCPKYKAV 142 (157)
Q Consensus 85 ~s~~~~~~i~C~~~~~~~~~~~~~~~~~~~~C~~~lCeCDr~~A~C~~~~~~~~~~~~ 142 (157)
.|+|. +..++|+++||||||+||+||++++|+.+...
T Consensus 73 -------~i~C~--------------~~~~~C~~~lCeCD~~~a~Cf~r~~YN~~y~~ 109 (123)
T d1le6a_ 73 -------SVLCG--------------PAENKCQELLCKCDQEIANCLAQTEYNLKYLF 109 (123)
T ss_dssp -------EEEEC--------------CCSSHHHHHHHHHHHHHHHHHHTCCCCGGGBT
T ss_pred -------EeeEC--------------CCCChHHHHhchhhHHHHHHHHhCccCHhhcC
Confidence 99994 45679999999999999999999999886543
|
| >d1g0za_ a.133.1.2 (A:) Snake phospholipase A2 {Indian krait (Bungarus caeruleus), different isoforms [TaxId: 132961]} | Back information, alignment and structure |
|---|
| >d1ae7a_ a.133.1.2 (A:) Snake phospholipase A2 {Mainland tiger snake (Notechis scutatus scutatus), notexin [TaxId: 8663]} | Back information, alignment and structure |
|---|
| >d1buna_ a.133.1.2 (A:) Snake phospholipase A2 {Many-banded krait (Bungarus multicinctus), beta2-bungarotoxin [TaxId: 8616]} | Back information, alignment and structure |
|---|
| >d1n28a_ a.133.1.2 (A:) Phospholipase A2 {Human (Homo sapiens), synovial fluid [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sz8a_ a.133.1.2 (A:) Snake phospholipase A2 {Andaman cobra (Naja sagittifera), acidic isoform 1 [TaxId: 195058]} | Back information, alignment and structure |
|---|
| >d1m8ta_ a.133.1.2 (A:) Snake phospholipase A2 {King cobra (Ophiophagus hannah), an acidic isoform [TaxId: 8665]} | Back information, alignment and structure |
|---|
| >d1p7oa_ a.133.1.2 (A:) Snake phospholipase A2 {Small-eye snake (Micropechis ikaheka), different isoforms [TaxId: 66188]} | Back information, alignment and structure |
|---|
| >d1g4ia_ a.133.1.2 (A:) Phospholipase A2 {Cow (Bos taurus), pancreas [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2g58a1 a.133.1.2 (A:1-133) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]} | Back information, alignment and structure |
|---|
| >d1gmza_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Bothrops pirajai), piratoxin III [TaxId: 113192]} | Back information, alignment and structure |
|---|
| >d1zlba1 a.133.1.2 (A:1-122) Snake phospholipase A2 {Jararacussu (Bothrops jararacussu) [TaxId: 8726]} | Back information, alignment and structure |
|---|
| >d1oz6a_ a.133.1.2 (A:) Snake phospholipase A2 {Saw-scaled viper (Echis carinatus) [TaxId: 40353]} | Back information, alignment and structure |
|---|
| >d1jltb_ a.133.1.2 (B:) Snake phospholipase A2 {Sand viper (Vipera ammodytes meridionalis), vipoxin catalytic subunit [TaxId: 8704]} | Back information, alignment and structure |
|---|
| >d1m8ra_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Agkistrodon halys) [TaxId: 8714]} | Back information, alignment and structure |
|---|
| >d1jiaa_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Agkistrodon halys) [TaxId: 8714]} | Back information, alignment and structure |
|---|
| >d1jlta_ a.133.1.2 (A:) Snake phospholipase A2 {Sand viper (Vipera ammodytes meridionalis), vipoxin inhibitor [TaxId: 8704]} | Back information, alignment and structure |
|---|
| >d1vipa_ a.133.1.2 (A:) Snake phospholipase A2 {Russell's viper (Vipera russelli) [TaxId: 8707]} | Back information, alignment and structure |
|---|
| >d1mc2a_ a.133.1.2 (A:) Snake phospholipase A2 {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} | Back information, alignment and structure |
|---|
| >d1ppaa_ a.133.1.2 (A:) Snake phospholipase A2 {Eastern cottonmouth snake (Agkistrodon piscivorus piscivorus) [TaxId: 8716]} | Back information, alignment and structure |
|---|
| >d1bjja_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Agkistrodon halys) [TaxId: 8714]} | Back information, alignment and structure |
|---|
| >d1poca_ a.133.1.1 (A:) Phospholipase A2 {European honeybee (Apis mellifera) [TaxId: 7460]} | Back information, alignment and structure |
|---|