Diaphorina citri psyllid: psy12217


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260--
MSILYAIPNTVSTLKFPELNNLSGARVNATCGTLSKNYHEVRCHPAPDAFNPCEDLMGNWALRVSVWFVAIAALVGNLAVLLVLISSRFRMTVPKFLMCNLAFADFCMGLYLIMIAIMDVRSIGDYFNHAIYWQRGMGCQMAGFLTVFSSVLSIFTLTVITCERWYTITYAIHLNRRLKLSTATKIMVVGWVYSIAMAALPLFDVSNYSKTSICLPMKNTNSTDSAYLIFLLLFNGLAFWMICACYARMYSSIRGGTEGVAY
ccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc
*SILYAIPNTVSTLKFPELNNLSGARVNATCGTLSKNYHEVRCHPAPDAFNPCEDLMGNWALRVSVWFVAIAALVGNLAVLLVLISSRFRMTVPKFLMCNLAFADFCMGLYLIMIAIMDVRSIGDYFNHAIYWQRGMGCQMAGFLTVFSSVLSIFTLTVITCERWYTITYAIHLNRRLKLSTATKIMVVGWVYSIAMAALPLFDVSNYSKTSICLPMKNTNSTDSAYLIFLLLFNGLAFWMICACYARMYSSIR*G******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSILYAIPNTVSTLKFPELNNLSGARVNATCGTLSKNYHEVRCHPAPDAFNPCEDLMGNWALRVSVWFVAIAALVGNLAVLLVLISSRFRMTVPKFLMCNLAFADFCMGLYLIMIAIMDVRSIGDYFNHAIYWQRGMGCQMAGFLTVFSSVLSIFTLTVITCERWYTITYAIHLNRRLKLSTATKIMVVGWVYSIAMAALPLFDVSNYSKTSICLPMKNTNSTDSAYLIFLLLFNGLAFWMICACYARMYSSIRGGTEGVAY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Lutropin-choriogonadotropic hormone receptor Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.confidentP22888
Lutropin-choriogonadotropic hormone receptor Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.confidentP30730
Lutropin-choriogonadotropic hormone receptor Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.confidentQ28005

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0046886 [BP]positive regulation of hormone biosynthetic processprobableGO:0009889, GO:0032352, GO:0019222, GO:0032350, GO:0031326, GO:0031325, GO:0031328, GO:0031323, GO:0050794, GO:0065007, GO:0046885, GO:0048518, GO:0008150, GO:0048522, GO:0009891, GO:0050789, GO:0009893
GO:0043950 [BP]positive regulation of cAMP-mediated signalingprobableGO:0043949, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0032962 [BP]positive regulation of inositol trisphosphate biosynthetic processprobableGO:0019220, GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0031323, GO:0060732, GO:0050789, GO:0080090, GO:0010562, GO:0009891, GO:0065007, GO:0045913, GO:0045937, GO:0009889, GO:0050794, GO:0051174, GO:0048518, GO:0008150, GO:0010675, GO:0010676, GO:0043255, GO:0010919, GO:0032960, GO:0006109, GO:0048522
GO:0008528 [MF]G-protein coupled peptide receptor activityprobableGO:0004930, GO:0038023, GO:0060089, GO:0004888, GO:0001653, GO:0003674, GO:0004872, GO:0004871
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0005764 [CC]lysosomeprobableGO:0005737, GO:0000323, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005768 [CC]endosomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0043235 [CC]receptor complexprobableGO:0043234, GO:0005575, GO:0032991
GO:0007188 [BP]adenylate cyclase-modulating G-protein coupled receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0050789, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0007186, GO:0007187, GO:0044699
GO:0071371 [BP]cellular response to gonadotropin stimulusprobableGO:0071495, GO:0009719, GO:0051716, GO:0009725, GO:0050896, GO:0009987, GO:0071310, GO:0008150, GO:0032870, GO:0044763, GO:0070887, GO:0034698, GO:0042221, GO:0010033, GO:0044699
GO:0031233 [CC]intrinsic to external side of plasma membraneprobableGO:0009897, GO:0044459, GO:0009986, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0031226, GO:0031224
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0051281 [BP]positive regulation of release of sequestered calcium ion into cytosolprobableGO:0032388, GO:0060341, GO:0051049, GO:0032386, GO:0032846, GO:0032844, GO:0050789, GO:0043269, GO:0065007, GO:0048518, GO:0010522, GO:0051050, GO:0050794, GO:0010959, GO:0010524, GO:0008150, GO:0032879, GO:0043270, GO:0051928, GO:0051279, GO:0051924, GO:2000021, GO:0048522
GO:0009755 [BP]hormone-mediated signaling pathwayprobableGO:0071495, GO:0044700, GO:0051716, GO:0009719, GO:0070887, GO:0008150, GO:0009725, GO:0050896, GO:0009987, GO:0071310, GO:0050794, GO:0050789, GO:0032870, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0042221, GO:0007154, GO:0010033, GO:0044699
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0038106 [MF]choriogonadotropin hormone bindingprobableGO:0003674, GO:0042562, GO:0005488
GO:0042700 [BP]luteinizing hormone signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0007186, GO:0050789, GO:0044699
GO:0050850 [BP]positive regulation of calcium-mediated signalingprobableGO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050848, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0050794, GO:0048522
GO:0050482 [BP]arachidonic acid secretionprobableGO:0006869, GO:0046717, GO:0006820, GO:0015718, GO:0044699, GO:1901571, GO:0071702, GO:0033036, GO:0015909, GO:0015908, GO:0015849, GO:0006811, GO:0006810, GO:0015711, GO:0044765, GO:0008150, GO:0051234, GO:0010876, GO:0051179, GO:0046942, GO:0046903, GO:0071715, GO:0032309
GO:0016500 [MF]protein-hormone receptor activityprobableGO:0004930, GO:0038023, GO:0060089, GO:0004888, GO:0003674, GO:0004872, GO:0004871
GO:0008584 [BP]male gonad developmentprobableGO:0032502, GO:0022414, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0046546, GO:0061458, GO:0048856, GO:0008406, GO:0045137, GO:0007275, GO:0044767, GO:0003006, GO:0048513, GO:0008150, GO:0048731, GO:0046661, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4EA3, chain A
Confidence level:very confident
Coverage over the Query: 57-259
View the alignment between query and template
View the model in PyMOL
Template: 4AY9, chain X
Confidence level:probable
Coverage over the Query: 33-56
View the alignment between query and template
View the model in PyMOL