Diaphorina citri psyllid: psy12244


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------
SSVYFYSTEAAKPDSKATPYEDIPIARIRNFSIIAHVDHGKSTLADRLLEMTGTVLSSGSSQVLDSLQVEQERGITVKAQTASLRYTSILDGEEYLLNLIDTPGHVDFSNEVTRSLAACQGVVLLIDANQVDLKNANPEACEEQLQTLFNIDKKSVLRIWHRRCFSCADCHRSLDSTNLNDGLAKPDSKATPYEDIPIARIRNFSIIAHVDHGKSTLADRLLEMTGTVLSSGSSQVLDSLQVEQERGITVKAQTASL
ccEEEcccccccccccccccccccccccccEEEEEEEccccHHHHHHHHHHHccccccccccccccccHHHHcccEEEEcEEEEEEEEcccccEEEEEcccccccccccccccHHHHcccccEEEEEcccccccccccHHHHHHHHHHHcccccccEEEEcccccccHHHHHHHccccccccccccccccccccccccccCEEEEEEEEEEccEEEEEEEEEEcccccccccccccccccccccccccEEEcccEEc
*******************YEDIPIARIRNFSIIAHVDHGKSTLADRLLEMTGTVLSSGSSQVLDSLQVEQERGITVKAQTASLRYTSILDGEEYLLNLIDTPGHVDFSNEVTRSLAACQGVVLLIDANQVDLKNANPEACEEQLQTLFNIDKKSVLRIWHRRCFSCADCHRSLDSTNLNDGLAKPDSKATPYEDIPIARIRNFSIIAHVDHGKSTLADRLLEMTGTVLSSGSSQVLDSLQVEQERGITVKAQTASL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSVYFYSTEAAKPDSKATPYEDIPIARIRNFSIIAHVDHGKSTLADRLLEMTGTVLSSGSSQVLDSLQVEQERGITVKAQTASLRYTSILDGEEYLLNLIDTPGHVDFSNEVTRSLAACQGVVLLIDANQVDLKNANPEACEEQLQTLFNIDKKSVLRIWHRRCFSCADCHRSLDSTNLNDGLAKPDSKATPYEDIPIARIRNFSIIAHVDHGKSTLADRLLEMTGTVLSSGSSQVLDSLQVEQERGITVKAQTASL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Translation factor Guf1, mitochondrial Promotes mitochondrial protein synthesis. May act as a fidelity factor of the translation reaction, by catalyzing a one-codon backward translocation of tRNAs on improperly translocated ribosomes. Binds to mitochondrial ribosomes in a GTP-dependent manner.confidentQ8C3X4
Translation factor GUF1, mitochondrial Promotes mitochondrial protein synthesis. May act as a fidelity factor of the translation reaction, by catalyzing a one-codon backward translocation of tRNAs on improperly translocated ribosomes. Binds to mitochondrial ribosomes in a GTP-dependent manner.confidentQ8N442
Translation factor guf1, mitochondrial Promotes mitochondrial protein synthesis. May act as a fidelity factor of the translation reaction, by catalyzing a one-codon backward translocation of tRNAs on improperly translocated ribosomes. Binds to mitochondrial ribosomes in a GTP-dependent manner.confidentB6H2S6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009507 [CC]chloroplastprobableGO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0003924 [MF]GTPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0043022 [MF]ribosome bindingprobableGO:0043021, GO:0003674, GO:0005488
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0005761 [CC]mitochondrial ribosomeprobableGO:0031974, GO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0005739, GO:0030529, GO:0005759, GO:0000313, GO:0043231, GO:0032991, GO:0005840, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0006412 [BP]translationprobableGO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:1901576
GO:0045727 [BP]positive regulation of translationprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010608, GO:0009891, GO:2000112, GO:0051247, GO:0051246, GO:0032270, GO:0048518, GO:0065007, GO:0010468, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0032268, GO:0010557, GO:0010556, GO:0006417, GO:0048522
GO:0005525 [MF]GTP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0019001, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032561, GO:0032553, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005743 [CC]mitochondrial inner membraneprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CB4, chain D
Confidence level:very confident
Coverage over the Query: 26-54,80-221
View the alignment between query and template
View the model in PyMOL
Template: 2RDO, chain 7
Confidence level:very confident
Coverage over the Query: 199-239
View the alignment between query and template
View the model in PyMOL