Diaphorina citri psyllid: psy12252

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350------

MRVKQYKKKLDIIMPFVPAENPKCPACGKSVYAAEERVAGGYKFHKMCFKCSMCSKFLDSTNCTEHEKELYCRQCHGRKYGPKGYGFGGGAGCLSMDAGMCSKFLDSTNCTEHEKELYCRQCHGRKYGPKGYGFGGGAGCLSMDAGEHLTENNAPRTTVIDTAKIKAAPGKGCPRCGGVVFAAEQVLAKGSEWHRKCFKCRDCNKTLDSINACDGPDKDIYCKTCYGKKHKYCKACYGKNFGPKGFGYGHSPTLVSTSGESTMQFYDARPTSGLKGRNGDGCPRCGFVVYAAEQMISKNRIWHRRCFSCADCHRSLDSTNLNDGPDNDIYCRGCYGKNFGPKGCGFGLGAGALTMA

ccccccccccccccccccccccccccccccEEccEEEEEccccccccccccccccccccccccCECccCEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccc

********************NPKCPACGKSVYAAEERVAGGYKFHKMCFKCSMCSKFLDSTNCTEHEKELYCRQCHGRKYGPKGYGFGGGAGCLSMDAGMC*KFLDSTNCTEHEKELYCRQCHGRKYGPKGYGFGGGAGCLSM***************************KGCPRCGGVVFAAEQVLAKGSEWHRKCFKCRDCNKTLDSINACDGPDKDIYCKTCYGKKHKYCKACYGKNFGPKGFGYGHSPTLVSTS*********ARPTSGLKGRNGDGCPRCGFVVYAAEQMISKNRIWHRRCFSCADCHRSLDSTNLNDGPDNDIYCRGCYGKNFGPKGCGFGLGAGAL***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0048856 [BP]	anatomical structure development	probable	GO:0032502, GO:0008150
GO:0055120 [CC]	striated muscle dense body	probable	GO:0005737, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226, GO:0044422, GO:0044449
GO:0044699 [BP]	single-organism process	probable	GO:0008150
GO:0030018 [CC]	Z disc	probable	GO:0005737, GO:0005575, GO:0043229, GO:0043232, GO:0044464, GO:0031674, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0015629 [CC]	actin cytoskeleton	probable	GO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1B8T, chain A
Confidence level:very confident
Coverage over the Query: 18-93,187-225,237-242,274-356
View the alignment between query and template
View the model in PyMOL

Template: 2RGT, chain A
Confidence level:very confident
Coverage over the Query: 171-222,234-243,281-343
View the alignment between query and template
View the model in PyMOL

Template: 1M3V, chain A
Confidence level:very confident
Coverage over the Query: 19-129
View the alignment between query and template
View the model in PyMOL