Psyllid ID: psy12252


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350------
MRVKQYKKKLDIIMPFVPAENPKCPACGKSVYAAEERVAGGYKFHKMCFKCSMCSKFLDSTNCTEHEKELYCRQCHGRKYGPKGYGFGGGAGCLSMDAGMCSKFLDSTNCTEHEKELYCRQCHGRKYGPKGYGFGGGAGCLSMDAGEHLTENNAPRTTVIDTAKIKAAPGKGCPRCGGVVFAAEQVLAKGSEWHRKCFKCRDCNKTLDSINACDGPDKDIYCKTCYGKKHKYCKACYGKNFGPKGFGYGHSPTLVSTSGESTMQFYDARPTSGLKGRNGDGCPRCGFVVYAAEQMISKNRIWHRRCFSCADCHRSLDSTNLNDGPDNDIYCRGCYGKNFGPKGCGFGLGAGALTMA
ccccccccccccccccccccccccccccccEEccEEEEEccccccccccccccccccccccccEEEccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccc
cccHHccccccccccccccccccccccccEEEEEEEEEEcccccccccEEHHHccccccccccccccccEEEcccHHHHcccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEcccccccccEEEHHcccccccccccccccccEEEcccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEHHHEEEcccccccccEEHHHcccccccccccccccccEEEcccHHHHcccccccccccccHHccc
MRVKQYKKKLDiimpfvpaenpkcpacgksvyAAEERvaggykfhkmcfkcsmcskfldstnctehekelycrqchgrkygpkgygfgggagclsmdagmcskfldstnctehekelycrqchgrkygpkgygfgggagclsmdagehltennaprttvidtakikaapgkgcprcggvVFAAEQVLAKGsewhrkcfkcrdcnktldsinacdgpdkdiycktcygkkhkyckacygknfgpkgfgyghsptlvstsgestmqfydarptsglkgrngdgcprcgFVVYAAEQMISknriwhrrcfscadchrsldstnlndgpdndiycrgcygknfgpkgcgfglgagaltma
mrvkqykkkldiimpfvpaenpkcpACGKSVYAAEERVAGGYKFHKMCFKCSMCSKFLDSTNCTEHEKELYCRQCHGRKYGPKGYGFGGGAGCLSMDAGMCSKFLDSTNCTEHEKELYCRQCHGRKYGPKGYGFGGGAGCLSMDAGEHLTENNAPRTTVIDTAKIKAAPGKGCPRCGGVVFAAEQVLAKGSEWHRKCFKCRDCNKTldsinacdgpdkdIYCKTCYGKKHKYCKACYGKNFGPKGFGYGHSPTLVSTSGESTMQFYDARPTsglkgrngdgcPRCGFVVYAAEQMISKNRIWHRRCFSCADCHRSldstnlndgpdnDIYCRGCYGKNFGPKGCGFGLGAGALTMA
MRVKQYKKKLDIIMPFVPAENPKCPACGKSVYAAEERVAGGYKFHKMCFKCSMCSKFLDSTNCTEHEKELYCRQCHgrkygpkgygfgggagCLSMDAGMCSKFLDSTNCTEHEKELYCRQCHgrkygpkgygfgggagCLSMDAGEHLTENNAPRTTVIDTAKIKAAPGKGCPRCGGVVFAAEQVLAKGSEWHRKCFKCRDCNKTLDSINACDGPDKDIYCKTCYGKKHKYCKACYGKNFGPKGFGYGHSPTLVSTSGESTMQFYDARPTSGLKGRNGDGCPRCGFVVYAAEQMISKNRIWHRRCFSCADCHRSLDSTNLNDGPDNDIYCRGCYGKNFGPKGCGFGLGAGALTMA
********KLDIIMPFVPAENPKCPACGKSVYAAEERVAGGYKFHKMCFKCSMCSKFLDSTNCTEHEKELYCRQCHGRKYGPKGYGFGGGAGCLSMDAGMCSKFLDSTNCTEHEKELYCRQCHGRKYGPKGYGFGGGAGCLSMDAGEHLTENNAPRTTVIDTAKIKAAPGKGCPRCGGVVFAAEQVLAKGSEWHRKCFKCRDCNKTLDSINACDGPDKDIYCKTCYGKKHKYCKACYGKNFGPKGFGYGHSPTLV**********************NGDGCPRCGFVVYAAEQMISKNRIWHRRCFSCADCHRSLDSTNLNDGPDNDIYCRGCYGKNFGPKGCGFGLGAGA****
*********************PKCPACGKSVYAAEERVAGGYKFHKMCFKCSMCSKFLDSTNCTEHEKELYCRQCHGRKYGPKGYGFGGGAGCLSMDAGM*********CTEHEKELYCRQCHG**********GGGAGCLSM*********************************GGVVFAAEQVLAKGSEWHRKCFKCRDCNKTLDS****DGPDKDIYCKTCYGKKHKYCKACYGKNFGPKGFGYGHSPTLVSTS*********ARPTSGLKGRNGDGCPRCGFVVYAAEQMISKNRIWHRRCFSCADCHRSLDSTNLNDGPDNDIYCRGCYGKNFGPKGCGFGLGAGAL***
MRVKQYKKKLDIIMPFVPAENPKCPACGKSVYAAEERVAGGYKFHKMCFKCSMCSKFLDSTNCTEHEKELYCRQCHGRKYGPKGYGFGGGAGCLSMDAGMCSKFLDSTNCTEHEKELYCRQCHGRKYGPKGYGFGGGAGCLSMDAGEHLTENNAPRTTVIDTAKIKAAPGKGCPRCGGVVFAAEQVLAKGSEWHRKCFKCRDCNKTLDSINACDGPDKDIYCKTCYGKKHKYCKACYGKNFGPKGFGYGHSPTLVSTSGESTMQFYDARPTSGLKGRNGDGCPRCGFVVYAAEQMISKNRIWHRRCFSCADCHRSLDSTNLNDGPDNDIYCRGCYGKNFGPKGCGFGLGAGALTMA
********************NPKCPACGKSVYAAEERVAGGYKFHKMCFKCSMCSKFLDSTNCTEHEKELYCRQCHGRKYGPKGYGFGGGAGCLSMDA**C*KFLDSTNCTEHEKELYCRQCHGRKYGPKGYGFGGGA********************************KGCPRCGGVVFAAEQVLAKGSEWHRKCFKCRDCNKTLDSINACDGPDKDIYCKTCYGKKHKYCKACYGKNF**************************************DGCPRCGFVVYAAEQMISKNRIWHRRCFSCADCHRSLDSTNLNDGPDNDIYCRGCYGKNFGPKGCGFGLG*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRVKQYKKKLDIIMPFVPAENPKCPACGKSVYAAEERVAGGYKFHKMCFKCSMCSKFLDSTNCTEHEKELYCRQCHGRKYGPKGYGFGGGAGCLSMDAGMCSKFLDSTNCTEHEKELYCRQCHGRKYGPKGYGFGGGAGCLSMDAGEHLTENNAPRTTVIDTAKIKAAPGKGCPRCGGVVFAAEQVLAKGSEWHRKCFKCRDCNKTLDSINACDGPDKDIYCKTCYGKKHKYCKACYGKNFGPKGFGYGHSPTLVSTSGESTMQFYDARPTSGLKGRNGDGCPRCGFVVYAAEQMISKNRIWHRRCFSCADCHRSLDSTNLNDGPDNDIYCRGCYGKNFGPKGCGFGLGAGALTMA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query356 2.2.26 [Sep-21-2011]
Q24400495 Muscle LIM protein Mlp84B no N/A 0.755 0.543 0.523 4e-87
P50462194 Cysteine and glycine-rich yes N/A 0.471 0.865 0.387 5e-33
P50463194 Cysteine and glycine-rich yes N/A 0.471 0.865 0.391 6e-33
P50461194 Cysteine and glycine-rich yes N/A 0.471 0.865 0.382 1e-32
P67967192 Cysteine and glycine-rich N/A N/A 0.449 0.833 0.461 1e-32
P67966192 Cysteine and glycine-rich yes N/A 0.449 0.833 0.461 1e-32
Q4U0T9194 Cysteine and glycine-rich yes N/A 0.471 0.865 0.374 3e-32
Q16527193 Cysteine and glycine-rich no N/A 0.488 0.901 0.437 5e-32
Q32LE9193 Cysteine and glycine-rich no N/A 0.488 0.901 0.437 5e-32
P97314193 Cysteine and glycine-rich no N/A 0.488 0.901 0.442 6e-32
>sp|Q24400|MLP2_DROME Muscle LIM protein Mlp84B OS=Drosophila melanogaster GN=Mlp84B PE=1 SV=1 Back     alignment and function desciption
 Score =  321 bits (823), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 176/336 (52%), Positives = 212/336 (63%), Gaps = 67/336 (19%)

Query: 24  CPACGKSVYAAEERVAGGYKFHKMCFKCSMCSKFLDSTNCTEHEKELYCRQCHGRKYGPK 83
           CP CG  VYAAE++++ G ++HK CF C                     + CH       
Sbjct: 222 CPRCGGVVYAAEQKLSKGREWHKKCFNC---------------------KDCH------- 253

Query: 84  GYGFGGGAGCLSMDAGMCSKFLDSTNCTE-HEKELYCRQCHGRKYGPKGYGFGGGAGCLS 142
                              K LDS N ++  ++++YCR C+G+K+GP GYGF  G+G L 
Sbjct: 254 -------------------KTLDSINASDGPDRDVYCRTCYGKKWGPHGYGFACGSGFLQ 294

Query: 143 MDAGEHLTENNAPRTTVI---DTAKIKAAPGKGCPRCGGVVFAAEQVLAKGSEWHRKCFK 199
            D    LTE+           DT  IKA  G+GCPRCGG VFAAEQ L+KG  WH+KC+ 
Sbjct: 295 TDG---LTEDQISANRPFYNPDTTSIKARDGEGCPRCGGAVFAAEQQLSKGKVWHKKCYN 351

Query: 200 CRDCNKTLDSINACDGPDKDIYCKTCYGKKHKYCKACYGKNFGPKGFGYGHSPTLVSTSG 259
           C DC++ LDS+ ACDGPD DI+C+           ACYGK FGPKGFGYGH+PTLVSTSG
Sbjct: 352 CADCHRPLDSVLACDGPDGDIHCR-----------ACYGKLFGPKGFGYGHAPTLVSTSG 400

Query: 260 ESTMQFYDARPTSGLKGRNGDGCPRCGFVVYAAEQMISKNRIWHRRCFSCADCHRSLDST 319
           EST+QF D RP +G K     GCPRCGF V+AAEQMISK RIWH+RCF C+DC +SLDST
Sbjct: 401 ESTIQFPDGRPLAGPK--TSGGCPRCGFAVFAAEQMISKTRIWHKRCFYCSDCRKSLDST 458

Query: 320 NLNDGPDNDIYCRGCYGKNFGPKGCGFGLGAGALTM 355
           NLNDGPD DIYCR CYG+NFGPKG G+GLGAGALT 
Sbjct: 459 NLNDGPDGDIYCRACYGRNFGPKGVGYGLGAGALTT 494




Plays a role in cell differentiation late in myogenesis. Transcription factor Mef2 is essential for expression.
Drosophila melanogaster (taxid: 7227)
>sp|P50462|CSRP3_MOUSE Cysteine and glycine-rich protein 3 OS=Mus musculus GN=Csrp3 PE=1 SV=1 Back     alignment and function description
>sp|P50463|CSRP3_RAT Cysteine and glycine-rich protein 3 OS=Rattus norvegicus GN=Csrp3 PE=1 SV=1 Back     alignment and function description
>sp|P50461|CSRP3_HUMAN Cysteine and glycine-rich protein 3 OS=Homo sapiens GN=CSRP3 PE=1 SV=1 Back     alignment and function description
>sp|P67967|CSRP1_COTJA Cysteine and glycine-rich protein 1 OS=Coturnix coturnix japonica GN=CSRP1 PE=2 SV=2 Back     alignment and function description
>sp|P67966|CSRP1_CHICK Cysteine and glycine-rich protein 1 OS=Gallus gallus GN=CSRP1 PE=1 SV=2 Back     alignment and function description
>sp|Q4U0T9|CSRP3_BOVIN Cysteine and glycine-rich protein 3 OS=Bos taurus GN=CSRP3 PE=2 SV=1 Back     alignment and function description
>sp|Q16527|CSRP2_HUMAN Cysteine and glycine-rich protein 2 OS=Homo sapiens GN=CSRP2 PE=1 SV=3 Back     alignment and function description
>sp|Q32LE9|CSRP2_BOVIN Cysteine and glycine-rich protein 2 OS=Bos taurus GN=CSRP2 PE=2 SV=3 Back     alignment and function description
>sp|P97314|CSRP2_MOUSE Cysteine and glycine-rich protein 2 OS=Mus musculus GN=Csrp2 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query356
92109966 505 IP07084p [Drosophila melanogaster] 0.921 0.649 0.511 7e-95
242019568 492 muscle lim protein, putative [Pediculus 0.929 0.672 0.493 1e-94
221468537 486 muscle LIM protein at 60A, isoform B [Dr 0.907 0.664 0.515 4e-94
157114447 488 muscle lim protein [Aedes aegypti] gi|10 0.938 0.684 0.465 4e-87
195036714 492 GH18591 [Drosophila grimshawi] gi|193894 0.755 0.546 0.520 8e-86
289742311 491 muscle LIM protein at 84B [Glossina mors 0.766 0.556 0.523 2e-85
17137134 495 muscle LIM protein at 84B, isoform A [Dr 0.755 0.543 0.523 3e-85
195392002 491 GJ22693 [Drosophila virilis] gi|19415273 0.755 0.547 0.523 3e-85
193718315 496 PREDICTED: muscle LIM protein Mlp84B-lik 0.764 0.548 0.519 3e-85
328788697 493 PREDICTED: muscle LIM protein Mlp84B-lik 0.764 0.551 0.513 4e-85
>gi|92109966|gb|ABE73307.1| IP07084p [Drosophila melanogaster] Back     alignment and taxonomy information
 Score =  353 bits (906), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 203/397 (51%), Positives = 249/397 (62%), Gaps = 69/397 (17%)

Query: 9   KLDIIMPFVPAENPKCPACGKSVYAAEERVAGGYKFHKMCFKCSMCSKFLDSTNCTEHEK 68
           +  I MPFVP E PKCPACGKSVYAAEERVAGGYKFHK CFKCSMC+K LDSTNCTEHEK
Sbjct: 15  RTQIKMPFVPVETPKCPACGKSVYAAEERVAGGYKFHKTCFKCSMCNKALDSTNCTEHEK 74

Query: 69  ELYCRQCHGRKYGPKGYGFGGGAGCLSMDAG----------------------------- 99
           EL+C+ CHGRKYGPKGYGFGGGAGCLS D G                             
Sbjct: 75  ELFCKNCHGRKYGPKGYGFGGGAGCLSTDTGAHLNREFVPPKIPPKAPDGLGCPRCGIYV 134

Query: 100 ---------------------MCSKFLDST-NCTEHEKELYCRQCHGRKYGPKGYGFGG- 136
                                 C+K LDST +C   +K++YCR C+ +K+G +GYG  G 
Sbjct: 135 YAAEQMLARGKGYHRRCFKCVQCNKTLDSTLHCDGPDKDIYCRGCYAQKFGARGYGHIGI 194

Query: 137 -GAGCLSMDAGEHLTENNAPRTTVIDTAKIKAAPGKGCPRCGGVVFAAEQVLAKGSEWHR 195
              G +S         + AP+ ++I+  +I+A  G+GCPRCGGVVFAAEQVL+KG  WHR
Sbjct: 195 SSLGLMSDIRDSEWQSDMAPKASIINVEQIQAPIGEGCPRCGGVVFAAEQVLSKGRSWHR 254

Query: 196 KCFKCRDCNKTLDSINACDGPDKDIYCKTCYGKKHKYCKACYGKNFGPKGFGYGHSPTLV 255
           KCFKCRDC KTLDSI ACDGPD ++YCKTCYGKK           +GP G+G+    + +
Sbjct: 255 KCFKCRDCTKTLDSIIACDGPDNEVYCKTCYGKK-----------WGPHGYGFACGSSFL 303

Query: 256 STSGESTMQFYDARP-----TSGLKGRNGDGCPRCGFVVYAAEQMISKNRIWHRRCFSCA 310
            T G +       RP     T+ +   +G+GCPRCG  V+AAE  +SK +++HR+CF+CA
Sbjct: 304 QTDGITEENLASERPFVAPDTTSIMAPDGEGCPRCGGAVFAAELQLSKGKMYHRKCFNCA 363

Query: 311 DCHRSLDSTNLNDGPDNDIYCRGCYGKNFGPKGCGFG 347
            C R LDS    DGPD++IYC+ CY K FGPKG G+G
Sbjct: 364 RCTRPLDSVLACDGPDDNIYCKLCYAKLFGPKGVGYG 400




Source: Drosophila melanogaster

Species: Drosophila melanogaster

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242019568|ref|XP_002430232.1| muscle lim protein, putative [Pediculus humanus corporis] gi|212515332|gb|EEB17494.1| muscle lim protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|221468537|ref|NP_001137750.1| muscle LIM protein at 60A, isoform B [Drosophila melanogaster] gi|220902371|gb|ACL83203.1| muscle LIM protein at 60A, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|157114447|ref|XP_001652275.1| muscle lim protein [Aedes aegypti] gi|108877265|gb|EAT41490.1| AAEL006866-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|195036714|ref|XP_001989813.1| GH18591 [Drosophila grimshawi] gi|193894009|gb|EDV92875.1| GH18591 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|289742311|gb|ADD19903.1| muscle LIM protein at 84B [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|17137134|ref|NP_477122.1| muscle LIM protein at 84B, isoform A [Drosophila melanogaster] gi|24644746|ref|NP_731134.1| muscle LIM protein at 84B, isoform B [Drosophila melanogaster] gi|195498856|ref|XP_002096704.1| GE25818 [Drosophila yakuba] gi|2497676|sp|Q24400.1|MLP2_DROME RecName: Full=Muscle LIM protein Mlp84B gi|987834|emb|CAA62627.1| muscle LIM protein [Drosophila melanogaster] gi|3659881|gb|AAC61591.1| muscle LIM protein at 84B [Drosophila melanogaster] gi|7298855|gb|AAF54063.1| muscle LIM protein at 84B, isoform A [Drosophila melanogaster] gi|7298856|gb|AAF54064.1| muscle LIM protein at 84B, isoform B [Drosophila melanogaster] gi|27819817|gb|AAO24957.1| RE40142p [Drosophila melanogaster] gi|194182805|gb|EDW96416.1| GE25818 [Drosophila yakuba] gi|220942504|gb|ACL83795.1| Mlp84B-PA [synthetic construct] gi|220952718|gb|ACL88902.1| Mlp84B-PA [synthetic construct] Back     alignment and taxonomy information
>gi|195392002|ref|XP_002054648.1| GJ22693 [Drosophila virilis] gi|194152734|gb|EDW68168.1| GJ22693 [Drosophila virilis] Back     alignment and taxonomy information
>gi|193718315|ref|XP_001950563.1| PREDICTED: muscle LIM protein Mlp84B-like isoform 1 [Acyrthosiphon pisum] gi|328708622|ref|XP_003243749.1| PREDICTED: muscle LIM protein Mlp84B-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328788697|ref|XP_394758.3| PREDICTED: muscle LIM protein Mlp84B-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query356
FB|FBgn0014863495 Mlp84B "Muscle LIM protein at 0.674 0.484 0.585 1.2e-108
UNIPROTKB|F1NMV9194 CSRP1 "Cysteine and glycine-ri 0.480 0.881 0.482 1.4e-41
UNIPROTKB|P67966192 CSRP1 "Cysteine and glycine-ri 0.480 0.890 0.482 1.4e-41
UNIPROTKB|Q3MHY1193 CSRP1 "Cysteine and glycine-ri 0.477 0.880 0.461 1.3e-38
MGI|MGI:88549193 Csrp1 "cysteine and glycine-ri 0.477 0.880 0.456 1.6e-38
UNIPROTKB|P21291193 CSRP1 "Cysteine and glycine-ri 0.477 0.880 0.456 1.6e-38
RGD|62053193 Csrp1 "cysteine and glycine-ri 0.477 0.880 0.456 2.6e-38
UNIPROTKB|J9NYN2193 CSRP1 "Uncharacterized protein 0.477 0.880 0.456 3.4e-38
UNIPROTKB|I3LL97193 CSRP1 "Uncharacterized protein 0.477 0.880 0.456 3.4e-38
UNIPROTKB|F1RYJ8193 CSRP2 "Uncharacterized protein 0.488 0.901 0.437 8.9e-38
FB|FBgn0014863 Mlp84B "Muscle LIM protein at 84B" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 794 (284.6 bits), Expect = 1.2e-108, Sum P(2) = 1.2e-108
 Identities = 150/256 (58%), Positives = 175/256 (68%)

Query:   101 CSKFLDSTNCTEH-EKELYCRQCHXXXXXXXXXXXXXXXXCLSMDA-GEHLTENNAPRTT 158
             C K LDS N ++  ++++YCR C+                 L  D   E     N P   
Sbjct:   252 CHKTLDSINASDGPDRDVYCRTCYGKKWGPHGYGFACGSGFLQTDGLTEDQISANRPFYN 311

Query:   159 VIDTAKIKAAPGKGCPRCGGVVFAAEQVLAKGSEWHRKCFKCRDCNKTLDSINACDGPDK 218
               DT  IKA  G+GCPRCGG VFAAEQ L+KG  WH+KC+ C DC++ LDS+ ACDGPD 
Sbjct:   312 P-DTTSIKARDGEGCPRCGGAVFAAEQQLSKGKVWHKKCYNCADCHRPLDSVLACDGPDG 370

Query:   219 DIYCKTCYGKKHKYCKACYGKNFGPKGFGYGHSPTLVSTSGESTMQFYDARPTSGLKGRN 278
             DI+C+           ACYGK FGPKGFGYGH+PTLVSTSGEST+QF D RP +G K   
Sbjct:   371 DIHCR-----------ACYGKLFGPKGFGYGHAPTLVSTSGESTIQFPDGRPLAGPK--T 417

Query:   279 GDGCPRCGFVVYAAEQMISKNRIWHRRCFSCADCHRSLDSTNLNDGPDNDIYCRGCYGKN 338
               GCPRCGF V+AAEQMISK RIWH+RCF C+DC +SLDSTNLNDGPD DIYCR CYG+N
Sbjct:   418 SGGCPRCGFAVFAAEQMISKTRIWHKRCFYCSDCRKSLDSTNLNDGPDGDIYCRACYGRN 477

Query:   339 FGPKGCGFGLGAGALT 354
             FGPKG G+GLGAGALT
Sbjct:   478 FGPKGVGYGLGAGALT 493


GO:0060537 "muscle tissue development" evidence=IEP
GO:0015629 "actin cytoskeleton" evidence=IDA
GO:0005634 "nucleus" evidence=ISS;IDA;NAS
GO:0005737 "cytoplasm" evidence=NAS
GO:0007519 "skeletal muscle tissue development" evidence=NAS
GO:0030154 "cell differentiation" evidence=NAS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0008307 "structural constituent of muscle" evidence=IGI;IMP
GO:0045214 "sarcomere organization" evidence=IGI
GO:0030018 "Z disc" evidence=IDA
GO:0090175 "regulation of establishment of planar polarity" evidence=IMP
UNIPROTKB|F1NMV9 CSRP1 "Cysteine and glycine-rich protein 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P67966 CSRP1 "Cysteine and glycine-rich protein 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q3MHY1 CSRP1 "Cysteine and glycine-rich protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:88549 Csrp1 "cysteine and glycine-rich protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P21291 CSRP1 "Cysteine and glycine-rich protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|62053 Csrp1 "cysteine and glycine-rich protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9NYN2 CSRP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|I3LL97 CSRP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1RYJ8 CSRP2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query356
cd0940454 cd09404, LIM1_MLP84B_like, The LIM domain of Mlp84 3e-26
cd0932653 cd09326, LIM_CRP_like, The LIM domains of Cysteine 3e-21
cd0932653 cd09326, LIM_CRP_like, The LIM domains of Cysteine 6e-19
cd0932653 cd09326, LIM_CRP_like, The LIM domains of Cysteine 9e-19
cd0948254 cd09482, LIM2_CRP3, The second LIM domain of Cyste 7e-13
cd0940454 cd09404, LIM1_MLP84B_like, The LIM domain of Mlp84 2e-12
cd0940354 cd09403, LIM2_CRP, The second LIM domain of Cystei 3e-12
cd0940354 cd09403, LIM2_CRP, The second LIM domain of Cystei 5e-12
pfam0041258 pfam00412, LIM, LIM domain 2e-11
cd0940153 cd09401, LIM_TLP_like, The LIM domains of thymus L 2e-11
cd0948154 cd09481, LIM1_CRP3, The first LIM domain of Cystei 4e-11
cd0940354 cd09403, LIM2_CRP, The second LIM domain of Cystei 5e-11
cd0948254 cd09482, LIM2_CRP3, The second LIM domain of Cyste 6e-11
cd0984054 cd09840, LIM2_CRP2, The second LIM domain of Cyste 7e-11
cd0948254 cd09482, LIM2_CRP3, The second LIM domain of Cyste 2e-10
cd0948055 cd09480, LIM1_CRP2, The first LIM domain of Cystei 2e-10
cd0935853 cd09358, LIM_Mical_like, The LIM domain of Mical ( 3e-10
cd0940454 cd09404, LIM1_MLP84B_like, The LIM domain of Mlp84 4e-10
cd0984054 cd09840, LIM2_CRP2, The second LIM domain of Cyste 4e-10
cd0940253 cd09402, LIM1_CRP, The first LIM domain of Cystein 4e-10
cd0947956 cd09479, LIM1_CRP1, The first LIM domain of Cystei 4e-10
cd0984054 cd09840, LIM2_CRP2, The second LIM domain of Cyste 2e-09
cd0940153 cd09401, LIM_TLP_like, The LIM domains of thymus L 3e-09
smart0013254 smart00132, LIM, Zinc-binding domain present in Li 3e-08
cd0836853 cd08368, LIM, LIM is a small protein-protein inter 6e-08
cd0944553 cd09445, LIM_Mical_like_2, This domain belongs to 9e-08
cd0944063 cd09440, LIM1_SF3, The first Lim domain of pollen 1e-07
cd0935853 cd09358, LIM_Mical_like, The LIM domain of Mical ( 2e-07
cd0944553 cd09445, LIM_Mical_like_2, This domain belongs to 3e-07
cd0940153 cd09401, LIM_TLP_like, The LIM domains of thymus L 5e-07
cd0947854 cd09478, LIM_CRIP, The LIM domain of Cysteine-Rich 6e-07
cd0944161 cd09441, LIM2_SF3, The second Lim domain of pollen 7e-07
cd0944355 cd09443, LIM_Ltd-1, The LIM domain of LIM and tran 7e-07
cd0940061 cd09400, LIM_like_1, LIM domain in proteins of unk 1e-06
cd0948055 cd09480, LIM1_CRP2, The first LIM domain of Cystei 2e-06
smart0013254 smart00132, LIM, Zinc-binding domain present in Li 3e-06
cd0940253 cd09402, LIM1_CRP, The first LIM domain of Cystein 4e-06
cd0947956 cd09479, LIM1_CRP1, The first LIM domain of Cystei 4e-06
cd0836853 cd08368, LIM, LIM is a small protein-protein inter 6e-06
cd0947754 cd09477, LIM2_TLP, The second LIM domain of thymus 6e-06
pfam0041258 pfam00412, LIM, LIM domain 8e-06
cd0944355 cd09443, LIM_Ltd-1, The LIM domain of LIM and tran 9e-06
pfam0041258 pfam00412, LIM, LIM domain 1e-05
cd0948055 cd09480, LIM1_CRP2, The first LIM domain of Cystei 1e-05
cd0944553 cd09445, LIM_Mical_like_2, This domain belongs to 1e-05
cd0948154 cd09481, LIM1_CRP3, The first LIM domain of Cystei 2e-05
cd0836853 cd08368, LIM, LIM is a small protein-protein inter 2e-05
cd0947654 cd09476, LIM1_TLP, The first LIM domain of thymus 2e-05
cd0935853 cd09358, LIM_Mical_like, The LIM domain of Mical ( 3e-05
cd0947854 cd09478, LIM_CRIP, The LIM domain of Cysteine-Rich 3e-05
cd0947754 cd09477, LIM2_TLP, The second LIM domain of thymus 3e-05
cd0947654 cd09476, LIM1_TLP, The first LIM domain of thymus 3e-05
cd0948154 cd09481, LIM1_CRP3, The first LIM domain of Cystei 4e-05
cd0940253 cd09402, LIM1_CRP, The first LIM domain of Cystein 4e-05
cd0940061 cd09400, LIM_like_1, LIM domain in proteins of unk 4e-05
smart0013254 smart00132, LIM, Zinc-binding domain present in Li 5e-05
cd0947054 cd09470, LIM1_Lhx9, The first LIM domain of Lhx9 5e-05
cd0947956 cd09479, LIM1_CRP1, The first LIM domain of Cystei 8e-05
cd0940061 cd09400, LIM_like_1, LIM domain in proteins of unk 1e-04
cd0946964 cd09469, LIM1_Lhx2, The first LIM domain of Lhx2 1e-04
cd0944653 cd09446, LIM_N_RAP, The LIM domain of N-RAP 1e-04
cd0944753 cd09447, LIM_LASP, The LIM domain of LIM and SH3 P 1e-04
cd0947754 cd09477, LIM2_TLP, The second LIM domain of thymus 2e-04
cd0944753 cd09447, LIM_LASP, The LIM domain of LIM and SH3 P 2e-04
cd0935953 cd09359, LIM_LASP_like, The LIM domain of LIM and 2e-04
cd0935953 cd09359, LIM_LASP_like, The LIM domain of LIM and 3e-04
cd0934987 cd09349, LIM1_Zyxin, The first LIM domain of Zyxin 3e-04
cd0936954 cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of L 3e-04
cd0935953 cd09359, LIM_LASP_like, The LIM domain of LIM and 4e-04
cd0948553 cd09485, LIM_Eplin_alpha_beta, The Lim domain of E 5e-04
cd0944355 cd09443, LIM_Ltd-1, The LIM domain of LIM and tran 7e-04
cd0944653 cd09446, LIM_N_RAP, The LIM domain of N-RAP 9e-04
cd0944063 cd09440, LIM1_SF3, The first Lim domain of pollen 0.001
cd0944253 cd09442, LIM_Eplin_like, The Lim domain of Epithel 0.001
cd0947559 cd09475, LIM2_Lhx9, The second LIM domain of Lhx9 0.002
cd0947559 cd09475, LIM2_Lhx9, The second LIM domain of Lhx9 0.002
cd0947654 cd09476, LIM1_TLP, The first LIM domain of thymus 0.004
cd0944653 cd09446, LIM_N_RAP, The LIM domain of N-RAP 0.004
cd0936453 cd09364, LIM1_LIMK, The first LIM domain of LIMK ( 0.004
cd0939356 cd09393, LIM3_Lrg1p_like, The third LIM domain of 0.004
>gnl|CDD|188788 cd09404, LIM1_MLP84B_like, The LIM domain of Mlp84B and Mlp60A Back     alignment and domain information
 Score = 98.7 bits (246), Expect = 3e-26
 Identities = 45/54 (83%), Positives = 49/54 (90%)

Query: 23 KCPACGKSVYAAEERVAGGYKFHKMCFKCSMCSKFLDSTNCTEHEKELYCRQCH 76
          KCP CGKSVYAAEER+AGGYK+HKMCFKC MC+K LDSTNC EHE ELYC+QCH
Sbjct: 1  KCPKCGKSVYAAEERLAGGYKWHKMCFKCGMCNKLLDSTNCAEHEGELYCKQCH 54


The LIM domain of Mlp84B and Mlp60A: Mlp84B and Mlp60A belong to the CRP LIM domain protein family. The Mlp84B protein contains five copies of the LIM domains, each followed by a Glycin Rich Region (GRR). However, only the first LIM domain of Mlp84B is in this family. Mlp60A exhibits only one LIM domain linked to a glycin-rich region. Mlp84B and Mlp60A are muscle specific proteins and have been implicated in muscle differentiation. While Mlp84B transcripts are enriched at the terminal ends of muscle fibers, Mlp60A transcripts are found throughout the muscle fibers. All LIM domains are 50-60 amino acids in size and share two characteristic zinc finger motifs. The two zinc fingers contain eight conserved residues, mostly cysteines and histidines, which coordinately bond to two zinc atoms. LIM domains function as adaptors or scaffolds to support the assembly of multimeric protein complexes. Length = 54

>gnl|CDD|188712 cd09326, LIM_CRP_like, The LIM domains of Cysteine Rich Protein (CRP) family Back     alignment and domain information
>gnl|CDD|188712 cd09326, LIM_CRP_like, The LIM domains of Cysteine Rich Protein (CRP) family Back     alignment and domain information
>gnl|CDD|188712 cd09326, LIM_CRP_like, The LIM domains of Cysteine Rich Protein (CRP) family Back     alignment and domain information
>gnl|CDD|188866 cd09482, LIM2_CRP3, The second LIM domain of Cysteine Rich Protein 3 (CRP3/MLP) Back     alignment and domain information
>gnl|CDD|188788 cd09404, LIM1_MLP84B_like, The LIM domain of Mlp84B and Mlp60A Back     alignment and domain information
>gnl|CDD|188787 cd09403, LIM2_CRP, The second LIM domain of Cysteine Rich Protein (CRP) Back     alignment and domain information
>gnl|CDD|188787 cd09403, LIM2_CRP, The second LIM domain of Cysteine Rich Protein (CRP) Back     alignment and domain information
>gnl|CDD|215907 pfam00412, LIM, LIM domain Back     alignment and domain information
>gnl|CDD|188785 cd09401, LIM_TLP_like, The LIM domains of thymus LIM protein (TLP) Back     alignment and domain information
>gnl|CDD|188865 cd09481, LIM1_CRP3, The first LIM domain of Cysteine Rich Protein 3 (CRP3/MLP) Back     alignment and domain information
>gnl|CDD|188787 cd09403, LIM2_CRP, The second LIM domain of Cysteine Rich Protein (CRP) Back     alignment and domain information
>gnl|CDD|188866 cd09482, LIM2_CRP3, The second LIM domain of Cysteine Rich Protein 3 (CRP3/MLP) Back     alignment and domain information
>gnl|CDD|188871 cd09840, LIM2_CRP2, The second LIM domain of Cysteine Rich Protein 2 (CRP2) Back     alignment and domain information
>gnl|CDD|188866 cd09482, LIM2_CRP3, The second LIM domain of Cysteine Rich Protein 3 (CRP3/MLP) Back     alignment and domain information
>gnl|CDD|188864 cd09480, LIM1_CRP2, The first LIM domain of Cysteine Rich Protein 2 (CRP2) Back     alignment and domain information
>gnl|CDD|188744 cd09358, LIM_Mical_like, The LIM domain of Mical (molecule interacting with CasL) like family Back     alignment and domain information
>gnl|CDD|188788 cd09404, LIM1_MLP84B_like, The LIM domain of Mlp84B and Mlp60A Back     alignment and domain information
>gnl|CDD|188871 cd09840, LIM2_CRP2, The second LIM domain of Cysteine Rich Protein 2 (CRP2) Back     alignment and domain information
>gnl|CDD|188786 cd09402, LIM1_CRP, The first LIM domain of Cysteine Rich Protein (CRP) Back     alignment and domain information
>gnl|CDD|188863 cd09479, LIM1_CRP1, The first LIM domain of Cysteine Rich Protein 1 (CRP1) Back     alignment and domain information
>gnl|CDD|188871 cd09840, LIM2_CRP2, The second LIM domain of Cysteine Rich Protein 2 (CRP2) Back     alignment and domain information
>gnl|CDD|188785 cd09401, LIM_TLP_like, The LIM domains of thymus LIM protein (TLP) Back     alignment and domain information
>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers Back     alignment and domain information
>gnl|CDD|188829 cd09445, LIM_Mical_like_2, This domain belongs to the LIM domain family which are found on Mical (molecule interacting with CasL) like proteins Back     alignment and domain information
>gnl|CDD|188824 cd09440, LIM1_SF3, The first Lim domain of pollen specific protein SF3 Back     alignment and domain information
>gnl|CDD|188744 cd09358, LIM_Mical_like, The LIM domain of Mical (molecule interacting with CasL) like family Back     alignment and domain information
>gnl|CDD|188829 cd09445, LIM_Mical_like_2, This domain belongs to the LIM domain family which are found on Mical (molecule interacting with CasL) like proteins Back     alignment and domain information
>gnl|CDD|188785 cd09401, LIM_TLP_like, The LIM domains of thymus LIM protein (TLP) Back     alignment and domain information
>gnl|CDD|188862 cd09478, LIM_CRIP, The LIM domain of Cysteine-Rich Intestinal Protein (CRIP) Back     alignment and domain information
>gnl|CDD|188825 cd09441, LIM2_SF3, The second Lim domain of pollen specific protein SF3 Back     alignment and domain information
>gnl|CDD|188827 cd09443, LIM_Ltd-1, The LIM domain of LIM and transglutaminase domains protein (Ltd-1) Back     alignment and domain information
>gnl|CDD|188784 cd09400, LIM_like_1, LIM domain in proteins of unknown function Back     alignment and domain information
>gnl|CDD|188864 cd09480, LIM1_CRP2, The first LIM domain of Cysteine Rich Protein 2 (CRP2) Back     alignment and domain information
>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>gnl|CDD|188786 cd09402, LIM1_CRP, The first LIM domain of Cysteine Rich Protein (CRP) Back     alignment and domain information
>gnl|CDD|188863 cd09479, LIM1_CRP1, The first LIM domain of Cysteine Rich Protein 1 (CRP1) Back     alignment and domain information
>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers Back     alignment and domain information
>gnl|CDD|188861 cd09477, LIM2_TLP, The second LIM domain of thymus LIM protein (TLP) Back     alignment and domain information
>gnl|CDD|215907 pfam00412, LIM, LIM domain Back     alignment and domain information
>gnl|CDD|188827 cd09443, LIM_Ltd-1, The LIM domain of LIM and transglutaminase domains protein (Ltd-1) Back     alignment and domain information
>gnl|CDD|215907 pfam00412, LIM, LIM domain Back     alignment and domain information
>gnl|CDD|188864 cd09480, LIM1_CRP2, The first LIM domain of Cysteine Rich Protein 2 (CRP2) Back     alignment and domain information
>gnl|CDD|188829 cd09445, LIM_Mical_like_2, This domain belongs to the LIM domain family which are found on Mical (molecule interacting with CasL) like proteins Back     alignment and domain information
>gnl|CDD|188865 cd09481, LIM1_CRP3, The first LIM domain of Cysteine Rich Protein 3 (CRP3/MLP) Back     alignment and domain information
>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers Back     alignment and domain information
>gnl|CDD|188860 cd09476, LIM1_TLP, The first LIM domain of thymus LIM protein (TLP) Back     alignment and domain information
>gnl|CDD|188744 cd09358, LIM_Mical_like, The LIM domain of Mical (molecule interacting with CasL) like family Back     alignment and domain information
>gnl|CDD|188862 cd09478, LIM_CRIP, The LIM domain of Cysteine-Rich Intestinal Protein (CRIP) Back     alignment and domain information
>gnl|CDD|188861 cd09477, LIM2_TLP, The second LIM domain of thymus LIM protein (TLP) Back     alignment and domain information
>gnl|CDD|188860 cd09476, LIM1_TLP, The first LIM domain of thymus LIM protein (TLP) Back     alignment and domain information
>gnl|CDD|188865 cd09481, LIM1_CRP3, The first LIM domain of Cysteine Rich Protein 3 (CRP3/MLP) Back     alignment and domain information
>gnl|CDD|188786 cd09402, LIM1_CRP, The first LIM domain of Cysteine Rich Protein (CRP) Back     alignment and domain information
>gnl|CDD|188784 cd09400, LIM_like_1, LIM domain in proteins of unknown function Back     alignment and domain information
>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>gnl|CDD|188854 cd09470, LIM1_Lhx9, The first LIM domain of Lhx9 Back     alignment and domain information
>gnl|CDD|188863 cd09479, LIM1_CRP1, The first LIM domain of Cysteine Rich Protein 1 (CRP1) Back     alignment and domain information
>gnl|CDD|188784 cd09400, LIM_like_1, LIM domain in proteins of unknown function Back     alignment and domain information
>gnl|CDD|188853 cd09469, LIM1_Lhx2, The first LIM domain of Lhx2 Back     alignment and domain information
>gnl|CDD|188830 cd09446, LIM_N_RAP, The LIM domain of N-RAP Back     alignment and domain information
>gnl|CDD|188831 cd09447, LIM_LASP, The LIM domain of LIM and SH3 Protein (LASP) Back     alignment and domain information
>gnl|CDD|188861 cd09477, LIM2_TLP, The second LIM domain of thymus LIM protein (TLP) Back     alignment and domain information
>gnl|CDD|188831 cd09447, LIM_LASP, The LIM domain of LIM and SH3 Protein (LASP) Back     alignment and domain information
>gnl|CDD|188745 cd09359, LIM_LASP_like, The LIM domain of LIM and SH3 Protein (LASP)-like proteins Back     alignment and domain information
>gnl|CDD|188745 cd09359, LIM_LASP_like, The LIM domain of LIM and SH3 Protein (LASP)-like proteins Back     alignment and domain information
>gnl|CDD|188735 cd09349, LIM1_Zyxin, The first LIM domain of Zyxin Back     alignment and domain information
>gnl|CDD|188755 cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of Lhx2 and Lhx9 family Back     alignment and domain information
>gnl|CDD|188745 cd09359, LIM_LASP_like, The LIM domain of LIM and SH3 Protein (LASP)-like proteins Back     alignment and domain information
>gnl|CDD|188869 cd09485, LIM_Eplin_alpha_beta, The Lim domain of Epithelial Protein Lost in Neoplasm (Eplin) Back     alignment and domain information
>gnl|CDD|188827 cd09443, LIM_Ltd-1, The LIM domain of LIM and transglutaminase domains protein (Ltd-1) Back     alignment and domain information
>gnl|CDD|188830 cd09446, LIM_N_RAP, The LIM domain of N-RAP Back     alignment and domain information
>gnl|CDD|188824 cd09440, LIM1_SF3, The first Lim domain of pollen specific protein SF3 Back     alignment and domain information
>gnl|CDD|188826 cd09442, LIM_Eplin_like, The Lim domain of Epithelial Protein Lost in Neoplasm (Eplin) like proteins Back     alignment and domain information
>gnl|CDD|188859 cd09475, LIM2_Lhx9, The second LIM domain of Lhx9 Back     alignment and domain information
>gnl|CDD|188859 cd09475, LIM2_Lhx9, The second LIM domain of Lhx9 Back     alignment and domain information
>gnl|CDD|188860 cd09476, LIM1_TLP, The first LIM domain of thymus LIM protein (TLP) Back     alignment and domain information
>gnl|CDD|188830 cd09446, LIM_N_RAP, The LIM domain of N-RAP Back     alignment and domain information
>gnl|CDD|188750 cd09364, LIM1_LIMK, The first LIM domain of LIMK (LIM domain Kinase ) Back     alignment and domain information
>gnl|CDD|188779 cd09393, LIM3_Lrg1p_like, The third LIM domain of Lrg1p, a LIM and RhoGap domain containing protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 356
KOG2272|consensus332 99.98
KOG1701|consensus468 99.97
KOG1044|consensus 670 99.89
KOG2272|consensus332 99.89
KOG1703|consensus479 99.88
KOG1701|consensus468 99.85
KOG1703|consensus479 99.73
KOG4577|consensus 383 99.71
KOG4577|consensus 383 99.71
KOG1044|consensus 670 99.64
KOG1700|consensus200 99.48
PF0041258 LIM: LIM domain; InterPro: IPR001781 Zinc finger ( 99.46
PF0041258 LIM: LIM domain; InterPro: IPR001781 Zinc finger ( 99.4
KOG1700|consensus200 99.36
smart0013239 LIM Zinc-binding domain present in Lin-11, Isl-1, 98.6
smart0013239 LIM Zinc-binding domain present in Lin-11, Isl-1, 98.55
KOG1702|consensus 264 97.61
KOG1702|consensus264 97.34
KOG0490|consensus235 96.37
KOG0490|consensus235 95.88
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 88.82
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 84.88
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 82.35
>KOG2272|consensus Back     alignment and domain information
Probab=99.98  E-value=8.8e-36  Score=259.82  Aligned_cols=270  Identities=22%  Similarity=0.423  Sum_probs=212.3

Q ss_pred             CCCCCCCCCCCCCccccceEEE-eCCceeccCCcccccccccccCCCccccCCcccCccccccccCCCCCccCC---Ccc
Q psy12252         17 VPAENPKCPACGKSVYAAEERV-AGGYKFHKMCFKCSMCSKFLDSTNCTEHEKELYCRQCHGRKYGPKGYGFGG---GAG   92 (356)
Q Consensus        17 ~~~~~~~C~~C~~~I~~~~~i~-~~~~~~H~~CF~C~~C~~~L~~~~~~~~~g~~yC~~cy~~~~~~~c~~c~~---~~~   92 (356)
                      +..++..|..|......++.++ .+|..||..||.|+.|-.||.++.||+.+|+.||+.++..+|+|-|.+|++   +..
T Consensus         8 ~g~~~~~C~RC~~gF~~~e~~vns~ge~wH~~CFvCAQCf~pf~~g~~~efEgRkYCEhDF~~LfaPcC~kC~EFiiGrV   87 (332)
T KOG2272|consen    8 SGLANMVCERCRDGFEPAEKIVNSNGELWHEQCFVCAQCFRPFPDGIFYEFEGRKYCEHDFHVLFAPCCGKCGEFIIGRV   87 (332)
T ss_pred             hHHHHHHHHHHhccCCchhhhhccCchhhHHHHHHHHHhcCcCCCceeEEecCcccccccchhhhchhhcccccchhhHH
Confidence            3456678999999998888665 688999999999999999999999999999999999999999999999998   234


Q ss_pred             eeeccc---------ccccccCCCCcccccCCceecccCcCcccCCCC--CCCCCCCCcCCCCcccccccC---------
Q psy12252         93 CLSMDA---------GMCSKFLDSTNCTEHEKELYCRQCHGRKYGPKG--YGFGGGAGCLSMDAGEHLTEN---------  152 (356)
Q Consensus        93 ~~~~~~---------~~c~~~l~~~~~~~~~~~~~C~~c~~~~~~p~~--~~~~~g~~~~~~d~~~~~~~~---------  152 (356)
                      +.+|+.         ..|++.|.+..|.-..|+..|..|.++.-+..-  ..+......+..+...+-+.+         
T Consensus        88 ikamnnSwHp~CF~Cd~Cn~~Lad~gf~rnqgr~LC~~Cn~k~Ka~~~g~YvC~KCh~~iD~~~l~fr~d~yH~yHFkCt  167 (332)
T KOG2272|consen   88 IKAMNNSWHPACFRCDLCNKHLADQGFYRNQGRALCRECNQKEKAKGRGRYVCQKCHAHIDEQPLTFRGDPYHPYHFKCT  167 (332)
T ss_pred             HHhhccccCcccchhHHHHHHHhhhhhHhhcchHHhhhhhhhhcccccceeehhhhhhhcccccccccCCCCCccceecc
Confidence            555553         388899999999988999999998876321100  000001112222222221111         


Q ss_pred             -------CCCCc---cccccccccCCCCCCCCCCCceEecceeeccCCCcccccccccccCcCcCCCCccccCCCCceec
Q psy12252        153 -------NAPRT---TVIDTAKIKAAPGKGCPRCGGVVFAAEQVLAKGSEWHRKCFKCRDCNKTLDSINACDGPDKDIYC  222 (356)
Q Consensus       153 -------~~~~~---~~~~~~~~~~~~~~~C~~C~~~I~~~~~i~a~~~~~H~~CF~C~~C~~~l~~~~~~~~~~g~~~C  222 (356)
                             +..+.   .+++..+......++|..|++||. +.+|.++|+.||+++|+|+.|.+|+-+-..+ ++.|..||
T Consensus       168 ~C~keL~sdaRevk~eLyClrChD~mgipiCgaC~rpIe-ervi~amgKhWHveHFvCa~CekPFlGHrHY-EkkGlaYC  245 (332)
T KOG2272|consen  168 TCGKELTSDAREVKGELYCLRCHDKMGIPICGACRRPIE-ERVIFAMGKHWHVEHFVCAKCEKPFLGHRHY-EKKGLAYC  245 (332)
T ss_pred             cccccccchhhhhccceeccccccccCCcccccccCchH-HHHHHHhccccchhheeehhcCCcccchhhh-hhcCchhH
Confidence                   00000   244455555566789999999997 4567899999999999999999998776654 59999999


Q ss_pred             ccccccCCcccccccccccCCCcccCCCCCceeecCCCCccccCCCCCCCCCCCCCCCCCCCCCceeecceEEEeCCccc
Q psy12252        223 KTCYGKKHKYCKACYGKNFGPKGFGYGHSPTLVSTSGESTMQFYDARPTSGLKGRNGDGCPRCGFVVYAAEQMISKNRIW  302 (356)
Q Consensus       223 ~~c~~~~~~~C~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~g~~~~~~~~C~~C~~~I~~~e~v~~~g~~~  302 (356)
                                 +.+|.++||.                                     .|..|+.+|. |+++.+.++.|
T Consensus       246 -----------e~h~~qLfG~-------------------------------------~CF~C~~~i~-G~vv~al~Kaw  276 (332)
T KOG2272|consen  246 -----------ETHYHQLFGN-------------------------------------LCFICNRVIG-GDVVSALNKAW  276 (332)
T ss_pred             -----------HHHHHHHhhh-------------------------------------hheecCCccC-ccHHHHhhhhh
Confidence                       8889999985                                     7999999996 78899999999


Q ss_pred             ccCcccccccCCCCCCCCCccCCCCcccccccccc
Q psy12252        303 HRRCFSCADCHRSLDSTNLNDGPDNDIYCRGCYGK  337 (356)
Q Consensus       303 H~~CF~C~~C~~~L~~~~~~~~~~g~~yC~~c~~~  337 (356)
                      -++||+|+.|.+.|+..+.+++.|.+|.|++||++
T Consensus       277 Cv~cf~Cs~Cdkkl~~K~Kf~E~DmkP~CKkCy~r  311 (332)
T KOG2272|consen  277 CVECFSCSTCDKKLTQKNKFYEFDMKPVCKKCYDR  311 (332)
T ss_pred             ccccccccccccccccccceeeeccchHHHHHHhh
Confidence            99999999999999999877789999999999984



>KOG1701|consensus Back     alignment and domain information
>KOG1044|consensus Back     alignment and domain information
>KOG2272|consensus Back     alignment and domain information
>KOG1703|consensus Back     alignment and domain information
>KOG1701|consensus Back     alignment and domain information
>KOG1703|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG1044|consensus Back     alignment and domain information
>KOG1700|consensus Back     alignment and domain information
>PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1700|consensus Back     alignment and domain information
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query356
1b8t_A192 Solution Structure Of The Chicken Crp1 Length = 192 5e-27
1qli_A113 Quail Cysteine And Glycine-Rich Protein, Nmr, 15 Mi 3e-19
1cxx_A113 Mutant R122a Of Quail Cysteine And Glycine-Rich Pro 2e-18
1ctl_A85 Structure Of The Carboxy-Terminal Lim Domain From T 7e-18
2o13_A58 Solution Structure Of The C-Terminal Lim Domain Of 2e-12
1a7i_A81 Amino-Terminal Lim Domain From Quail Cysteine And G 2e-12
2o10_A60 Solution Structure Of The N-Terminal Lim Domain Of 5e-09
2o10_A60 Solution Structure Of The N-Terminal Lim Domain Of 2e-06
2o10_A60 Solution Structure Of The N-Terminal Lim Domain Of 6e-06
1iml_A76 Cysteine Rich Intestinal Protein, Nmr, 48 Structure 1e-07
1iml_A76 Cysteine Rich Intestinal Protein, Nmr, 48 Structure 1e-05
2cu8_A76 Solution Structure Of The Lim Domain Of Human Cyste 8e-05
2cu8_A76 Solution Structure Of The Lim Domain Of Human Cyste 2e-04
>pdb|1B8T|A Chain A, Solution Structure Of The Chicken Crp1 Length = 192 Back     alignment and structure

Iteration: 1

Score = 118 bits (296), Expect = 5e-27, Method: Compositional matrix adjust. Identities = 75/173 (43%), Positives = 93/173 (53%), Gaps = 2/173 (1%) Query: 170 GKGCPRCGGVVFAAEQVLAKGSEWHRKCFKCRDCNKTLDSINACDGPDKDIYCKTCYGKK 229 GK C C V+ AE+V +GS +H+ CF C C K LDS D +IYCK+CYGKK Sbjct: 7 GKKCGVCQKAVYFAEEVQCEGSSFHKSCFLCMVCKKNLDSTTVAVHGD-EIYCKSCYGKK 65 Query: 230 HKYCKACYGKNFGPKGFGYGHSPTLVSTSGESTMQFYDARPTSGLKGRNGDGCPRCGFVV 289 + G G G S + G+S K DGCPRCG V Sbjct: 66 YGPKGKGKGMGAGTLSTDKGESLGIKYEEGQSHRPTNPNASRMAQKVGGSDGCPRCGQAV 125 Query: 290 YAAEQMISKNRIWHRRCFSCADCHRSLDSTNLNDGPDNDIYCRGCYGKNFGPK 342 YAAE++I + WH+ CF CA C +SL+ST L D D +IYC+GCY KNFGPK Sbjct: 126 YAAEKVIGAGKSWHKSCFRCAKCGKSLESTTLAD-KDGEIYCKGCYAKNFGPK 177
>pdb|1QLI|A Chain A, Quail Cysteine And Glycine-Rich Protein, Nmr, Minimized Average Structure Length = 113 Back     alignment and structure
>pdb|1CXX|A Chain A, Mutant R122a Of Quail Cysteine And Glycine-Rich Protein, Nmr, Minimized Structure Length = 113 Back     alignment and structure
>pdb|1CTL|A Chain A, Structure Of The Carboxy-Terminal Lim Domain From The Cysteine Rich Protein Crp Length = 85 Back     alignment and structure
>pdb|2O13|A Chain A, Solution Structure Of The C-Terminal Lim Domain Of MlpCRP3 Length = 58 Back     alignment and structure
>pdb|1A7I|A Chain A, Amino-Terminal Lim Domain From Quail Cysteine And Glycine- Rich Protein, Nmr, Minimized Average Structure Length = 81 Back     alignment and structure
>pdb|2O10|A Chain A, Solution Structure Of The N-Terminal Lim Domain Of MlpCRP3 Length = 60 Back     alignment and structure
>pdb|2O10|A Chain A, Solution Structure Of The N-Terminal Lim Domain Of MlpCRP3 Length = 60 Back     alignment and structure
>pdb|2O10|A Chain A, Solution Structure Of The N-Terminal Lim Domain Of MlpCRP3 Length = 60 Back     alignment and structure
>pdb|1IML|A Chain A, Cysteine Rich Intestinal Protein, Nmr, 48 Structures Length = 76 Back     alignment and structure
>pdb|1IML|A Chain A, Cysteine Rich Intestinal Protein, Nmr, 48 Structures Length = 76 Back     alignment and structure
>pdb|2CU8|A Chain A, Solution Structure Of The Lim Domain Of Human Cysteine-Rich Protein 2 Length = 76 Back     alignment and structure
>pdb|2CU8|A Chain A, Solution Structure Of The Lim Domain Of Human Cysteine-Rich Protein 2 Length = 76 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query356
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 8e-36
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 5e-32
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 6e-19
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 7e-24
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 2e-19
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 3e-15
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 2e-22
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 1e-17
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 1e-15
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 3e-21
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 3e-15
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 1e-14
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 3e-19
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 5e-13
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 7e-13
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 4e-14
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 3e-10
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 6e-09
2co8_A82 NEDD9 interacting protein with calponin homology a 3e-13
2co8_A82 NEDD9 interacting protein with calponin homology a 2e-11
2co8_A82 NEDD9 interacting protein with calponin homology a 3e-11
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 5e-13
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 2e-10
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 3e-09
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 2e-12
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 4e-07
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 4e-06
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 3e-12
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 1e-09
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 2e-08
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 6e-12
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 2e-08
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 2e-06
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 2e-04
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 1e-10
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 2e-06
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 2e-06
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 5e-04
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 1e-10
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 3e-08
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 4e-07
3f6q_B72 LIM and senescent cell antigen-like-containing dom 1e-10
3f6q_B72 LIM and senescent cell antigen-like-containing dom 1e-07
3f6q_B72 LIM and senescent cell antigen-like-containing dom 8e-07
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 2e-10
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 4e-10
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 5e-07
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 4e-10
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 3e-08
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 1e-07
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 6e-10
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 6e-06
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 9e-05
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 5e-09
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 1e-08
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 2e-08
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 6e-09
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 5e-06
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 4e-05
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 6e-09
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 2e-07
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 2e-05
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 7e-09
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 3e-06
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 4e-06
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 7e-09
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 9e-08
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 1e-06
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 8e-05
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 1e-08
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 2e-05
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 3e-05
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 1e-08
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 2e-06
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 5e-06
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 8e-08
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 2e-05
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 3e-05
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 1e-07
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 4e-05
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 1e-04
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 1e-07
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 2e-05
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 8e-05
2cuq_A80 Four and A half LIM domains 3; structural genomics 2e-07
2cuq_A80 Four and A half LIM domains 3; structural genomics 6e-05
2cuq_A80 Four and A half LIM domains 3; structural genomics 8e-05
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 3e-07
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 8e-05
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 4e-04
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 4e-07
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 5e-07
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 3e-05
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 5e-07
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 1e-06
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 2e-06
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 2e-06
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 4e-04
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 6e-04
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 2e-06
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 4e-04
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 2e-06
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 6e-05
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 2e-04
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 2e-06
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 7e-05
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 8e-04
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 4e-06
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 5e-05
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 4e-06
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 4e-06
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 5e-04
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 7e-06
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 6e-05
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 5e-04
2cor_A79 Pinch protein; LIM domain, particularly interestin 7e-05
2cor_A79 Pinch protein; LIM domain, particularly interestin 6e-04
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 3e-04
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
 Score =  128 bits (322), Expect = 8e-36
 Identities = 84/191 (43%), Positives = 103/191 (53%), Gaps = 2/191 (1%)

Query: 166 KAAPGKGCPRCGGVVFAAEQVLAKGSEWHRKCFKCRDCNKTLDSINACDGPDKDIYCKTC 225
               GK C  C   V+ AE+V  +GS +H+ CF C  C K LDS       D+ IYCK+C
Sbjct: 3   NWGGGKKCGVCQKAVYFAEEVQCEGSSFHKSCFLCMVCKKNLDSTTVAVHGDE-IYCKSC 61

Query: 226 YGKKHKYCKACYGKNFGPKGFGYGHSPTLVSTSGESTMQFYDARPTSGLKGRNGDGCPRC 285
           YGKK+       G   G      G S  +    G+S             K    DGCPRC
Sbjct: 62  YGKKYGPKGKGKGMGAGTLSTDKGESLGIKYEEGQSHRPTNPNASRMAQKVGGSDGCPRC 121

Query: 286 GFVVYAAEQMISKNRIWHRRCFSCADCHRSLDSTNLNDGPDNDIYCRGCYGKNFGPKGCG 345
           G  VYAAE++I   + WH+ CF CA C +SL+ST L D  D +IYC+GCY KNFGPKG G
Sbjct: 122 GQAVYAAEKVIGAGKSWHKSCFRCAKCGKSLESTTLAD-KDGEIYCKGCYAKNFGPKGFG 180

Query: 346 FGLGAGALTMA 356
           FG GAGAL  +
Sbjct: 181 FGQGAGALIHS 191


>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 73 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query356
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 99.98
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 99.92
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 99.91
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 99.91
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 99.91
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 99.91
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 99.91
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 99.89
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 99.89
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 99.88
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 99.88
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 99.86
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 99.82
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 99.75
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 99.74
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 99.72
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 99.72
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 99.71
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 99.71
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 99.7
2cuq_A80 Four and A half LIM domains 3; structural genomics 99.69
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 99.69
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 99.68
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 99.65
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 99.64
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 99.64
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 99.62
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 99.62
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 99.62
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 99.62
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 99.61
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 99.61
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 99.61
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 99.61
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 99.6
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 99.6
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 99.59
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 99.59
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 99.59
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.59
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 99.58
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 99.58
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 99.58
2cuq_A80 Four and A half LIM domains 3; structural genomics 99.58
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 99.57
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 99.57
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 99.57
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 99.57
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 99.57
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 99.57
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.56
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 99.56
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 99.56
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 99.55
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 99.55
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 99.55
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.54
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 99.53
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 99.53
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 99.53
2co8_A82 NEDD9 interacting protein with calponin homology a 99.53
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.53
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 99.53
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 99.52
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 99.51
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 99.51
2co8_A82 NEDD9 interacting protein with calponin homology a 99.5
3f6q_B72 LIM and senescent cell antigen-like-containing dom 99.5
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 99.5
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 99.49
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 99.49
2cor_A79 Pinch protein; LIM domain, particularly interestin 99.48
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 99.48
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 99.47
2cor_A79 Pinch protein; LIM domain, particularly interestin 99.46
3f6q_B72 LIM and senescent cell antigen-like-containing dom 99.45
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 99.43
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 99.43
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 99.42
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 99.42
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 99.36
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 99.35
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 99.33
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 99.32
1zfo_A31 LAsp-1; LIM domain, zinc-finger, metal-binding pro 98.08
1zfo_A31 LAsp-1; LIM domain, zinc-finger, metal-binding pro 97.96
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Back     alignment and structure
Probab=99.98  E-value=1.1e-32  Score=242.62  Aligned_cols=188  Identities=47%  Similarity=0.906  Sum_probs=144.6

Q ss_pred             CCCCCCCCCCCCccccceEEEeCCceeccCCcccccccccccCCCccccCCcccCccccccccCCCCCccCCCcceeecc
Q psy12252         18 PAENPKCPACGKSVYAAEERVAGGYKFHKMCFKCSMCSKFLDSTNCTEHEKELYCRQCHGRKYGPKGYGFGGGAGCLSMD   97 (356)
Q Consensus        18 ~~~~~~C~~C~~~I~~~~~i~~~~~~~H~~CF~C~~C~~~L~~~~~~~~~g~~yC~~cy~~~~~~~c~~c~~~~~~~~~~   97 (356)
                      -...++|..|+++|..++.+.++|+.||++||+|..|+++|.+..|++++|++||+.||.++|+++|.+|+++.|+    
T Consensus         4 ~~~~~~C~~C~~~I~~~~~v~a~g~~wH~~CF~C~~C~~~L~~~~~~~~~g~~yC~~cy~~~f~~~c~~c~~~~g~----   79 (192)
T 1b8t_A            4 WGGGKKCGVCQKAVYFAEEVQCEGSSFHKSCFLCMVCKKNLDSTTVAVHGDEIYCKSCYGKKYGPKGKGKGMGAGT----   79 (192)
T ss_dssp             CCCCEECTTTCCEECSSCCEEETTEEECTTTCBCTTTCCBCCSSSEEEETTEEEEHHHHHHHHSCCCCCCCCCCCC----
T ss_pred             CCCCCcCccCCCeecceeEEEeCCceecCCCCcCcccCCcCCCCeeEecCCEeeChhhhHhhcCcccccccccccc----
Confidence            3456899999999997788889999999999999999999999999999999999999999999988766542211    


Q ss_pred             cccccccCCCCcccccCCceecccCcCcccCCCCCCCCCCCCcCCCCcccccccCCCCCccccccccccCCCCCCCCCCC
Q psy12252         98 AGMCSKFLDSTNCTEHEKELYCRQCHGRKYGPKGYGFGGGAGCLSMDAGEHLTENNAPRTTVIDTAKIKAAPGKGCPRCG  177 (356)
Q Consensus        98 ~~~c~~~l~~~~~~~~~~~~~C~~c~~~~~~p~~~~~~~g~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~  177 (356)
                                                                                                      
T Consensus        80 --------------------------------------------------------------------------------   79 (192)
T 1b8t_A           80 --------------------------------------------------------------------------------   79 (192)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             ceEecceeeccCCCcccccccccccCcCcCCCCccccCCCCceecccccccCCcccccccccccCCCcccCCCCCceeec
Q psy12252        178 GVVFAAEQVLAKGSEWHRKCFKCRDCNKTLDSINACDGPDKDIYCKTCYGKKHKYCKACYGKNFGPKGFGYGHSPTLVST  257 (356)
Q Consensus       178 ~~I~~~~~i~a~~~~~H~~CF~C~~C~~~l~~~~~~~~~~g~~~C~~c~~~~~~~C~~c~~~~~~~~~~~~~~~~~~~~~  257 (356)
                               .+.++.||   |.+..+.       .   ....+  ..+           ....+.               
T Consensus        80 ---------~~~~~~~~---~~~~~~~-------~---~~~~p--~~~-----------~~~~~~---------------  109 (192)
T 1b8t_A           80 ---------LSTDKGES---LGIKYEE-------G---QSHRP--TNP-----------NASRMA---------------  109 (192)
T ss_dssp             ---------CCCCCCCC---CCCCCCC-------C---CCCCC--CCC-----------CCCCCC---------------
T ss_pred             ---------EecCCCcc---ccccccc-------c---cccCC--CCc-----------Cccccc---------------
Confidence                     12234455   2221110       0   01111  000           000000               


Q ss_pred             CCCCccccCCCCCCCCCCCCCCCCCCCCCceeecceEEEeCCcccccCcccccccCCCCCCCCCccCCCCcccccccccc
Q psy12252        258 SGESTMQFYDARPTSGLKGRNGDGCPRCGFVVYAAEQMISKNRIWHRRCFSCADCHRSLDSTNLNDGPDNDIYCRGCYGK  337 (356)
Q Consensus       258 ~~~~~~~~~~~~p~~g~~~~~~~~C~~C~~~I~~~e~v~~~g~~~H~~CF~C~~C~~~L~~~~~~~~~~g~~yC~~c~~~  337 (356)
                                      ...++..+|++|+++|.+++.|.++++.||++||+|+.|+++|.++.|+ ..+|++||+.||.+
T Consensus       110 ----------------~~~~~~~~C~~C~~~I~~~~~v~a~~~~~H~~CF~C~~C~~~L~~~~~~-~~~g~~yC~~cy~~  172 (192)
T 1b8t_A          110 ----------------QKVGGSDGCPRCGQAVYAAEKVIGAGKSWHKSCFRCAKCGKSLESTTLA-DKDGEIYCKGCYAK  172 (192)
T ss_dssp             ----------------CCCCCCEECTTTSCEECSSSCEEETTEEECTTTCBCTTTCCBCCSSSEE-EETTEEEEHHHHHH
T ss_pred             ----------------cccCCCCcCCCCCCEecCcEEEecCCCccchhcCCccccCCCCCCCccc-ccCCEEeCHHHHHH
Confidence                            1112234799999999988889999999999999999999999988877 69999999999999


Q ss_pred             ccCCCccccCCCCCccccC
Q psy12252        338 NFGPKGCGFGLGAGALTMA  356 (356)
Q Consensus       338 ~f~~~~~~~~~~~~~~~~~  356 (356)
                      +||++|.+++.++|+|.|+
T Consensus       173 ~f~~kc~~C~~~~g~~~~~  191 (192)
T 1b8t_A          173 NFGPKGFGFGQGAGALIHS  191 (192)
T ss_dssp             HTCCCCCCCCCCCCCCCCC
T ss_pred             hcCCcCCCCCCcccceeec
Confidence            9999999999999999875



>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 Back     alignment and structure
>1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 356
d1b8ta265 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) pro 1e-18
d1b8ta265 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) pro 1e-18
d1b8ta265 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) pro 2e-15
d1b8ta265 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) pro 1e-10
d1b8ta449 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) pr 4e-16
d1b8ta449 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) pr 3e-14
d1b8ta449 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) pr 4e-14
d1b8ta449 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) pr 3e-09
d1imla248 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) prot 7e-11
d1imla248 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) prot 4e-09
d1imla248 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) prot 2e-06
d1imla248 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) prot 1e-05
d1b8ta343 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) pr 1e-06
d1b8ta343 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) pr 2e-06
d1b8ta343 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) pr 3e-06
d1a7ia232 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) prot 2e-06
d1a7ia232 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) prot 1e-05
d2d8ya135 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapien 2e-05
d2d8ya135 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapien 6e-04
d2d8ya135 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapien 0.002
d2cu8a130 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) prote 7e-05
d2cu8a130 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) prote 4e-04
d2cu8a130 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) prote 6e-04
d1ibia128 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) pr 1e-04
d1ibia128 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) pr 5e-04
d1ibia128 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) pr 0.001
d1ibia231 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) pr 6e-04
d2co8a236 g.39.1.3 (A:8-43) Nedd9 interacting protein with c 0.002
>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 65 Back     information, alignment and structure

class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: LIM domain
domain: Cysteine-rich (intestinal) protein, CRP, CRIP
species: Chicken (Gallus gallus) [TaxId: 9031]
 Score = 77.2 bits (190), Expect = 1e-18
 Identities = 28/49 (57%), Positives = 33/49 (67%)

Query: 51 CSMCSKFLDSTNCTEHEKELYCRQCHGRKYGPKGYGFGGGAGCLSMDAG 99
          C +C K LDST    H  E+YC+ C+G+KYGPKG G G GAG LS D G
Sbjct: 2  CMVCKKNLDSTTVAVHGDEIYCKSCYGKKYGPKGKGKGMGAGTLSTDKG 50


>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 65 Back     information, alignment and structure
>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 65 Back     information, alignment and structure
>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 65 Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 49 Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 49 Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 49 Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 49 Back     information, alignment and structure
>d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Length = 48 Back     information, alignment and structure
>d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Length = 48 Back     information, alignment and structure
>d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Length = 48 Back     information, alignment and structure
>d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Length = 48 Back     information, alignment and structure
>d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 43 Back     information, alignment and structure
>d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 43 Back     information, alignment and structure
>d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 43 Back     information, alignment and structure
>d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Length = 32 Back     information, alignment and structure
>d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Length = 32 Back     information, alignment and structure
>d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Length = 28 Back     information, alignment and structure
>d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Length = 28 Back     information, alignment and structure
>d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Length = 28 Back     information, alignment and structure
>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Length = 31 Back     information, alignment and structure
>d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query356
d1b8ta449 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 99.23
d1b8ta265 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 98.98
d1x3ha135 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 98.81
d1g47a235 Pinch (particularly interesting new Cys-His) prote 98.78
d1x3ha135 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 98.74
d1b8ta449 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 98.74
d1imla248 Cysteine-rich (intestinal) protein, CRP, CRIP {Rat 98.69
d1g47a235 Pinch (particularly interesting new Cys-His) prote 98.62
d1b8ta265 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 98.43
d2dara245 PDZ and LIM domain protein 5, Enigma {Human (Homo 98.38
d2dara245 PDZ and LIM domain protein 5, Enigma {Human (Homo 98.3
d1x63a137 Four and a half LIM domains protein 1, FHL-1 {Huma 98.29
d2cuqa235 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.26
d2d8ya242 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 98.25
d1b8ta343 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 98.24
d2cu8a130 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 98.19
d2d8ya135 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 98.16
d2d8xa226 Pinch (particularly interesting new Cys-His) prote 98.15
d2cu8a130 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 98.15
d2d8za232 Four and a half LIM domains protein 2, FHL2 {Human 98.15
d2d8za232 Four and a half LIM domains protein 2, FHL2 {Human 98.14
d2dj7a236 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 98.13
d2co8a236 Nedd9 interacting protein with calponin homology, 98.12
d1zfoa_30 LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} 98.12
d2dj7a131 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 98.1
d1b8ta343 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 98.09
d1imla248 Cysteine-rich (intestinal) protein, CRP, CRIP {Rat 98.07
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 98.06
d1ibia231 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 98.05
d2dj7a236 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 98.03
d2d8ya135 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 98.03
d1x63a137 Four and a half LIM domains protein 1, FHL-1 {Huma 98.02
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 98.01
d2cuqa235 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.01
d2cuqa132 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.99
d1x3ha232 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 97.97
d1zfoa_30 LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} 97.97
d2cuqa132 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.95
d2d8ya242 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 97.93
d1u5sb131 Pinch (particularly interesting new Cys-His) prote 97.93
d1u5sb131 Pinch (particularly interesting new Cys-His) prote 97.92
d1v6ga141 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 97.82
d1x3ha232 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 97.82
d2dara132 PDZ and LIM domain protein 5, Enigma {Human (Homo 97.82
d2co8a236 Nedd9 interacting protein with calponin homology, 97.81
d2dj7a131 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 97.79
d1ibia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.79
d1rutx130 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 97.78
d1u5sb235 Pinch (particularly interesting new Cys-His) prote 97.77
d1x4ka132 Four and a half LIM domains protein 2, FHL2 {Human 97.77
d2d8xa226 Pinch (particularly interesting new Cys-His) prote 97.77
d2d8za126 Four and a half LIM domains protein 2, FHL2 {Human 97.74
d1u5sb235 Pinch (particularly interesting new Cys-His) prote 97.73
d1wyha132 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.7
d2d8za126 Four and a half LIM domains protein 2, FHL2 {Human 97.69
d1rutx331 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 97.68
d2cura226 Four and a half LIM domains protein 1, FHL-1 {Huma 97.68
d2cu8a233 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 97.67
d2dloa233 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.66
d1j2oa130 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 97.65
d1ibia231 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.64
d2cu8a233 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 97.63
d2cura226 Four and a half LIM domains protein 1, FHL-1 {Huma 97.62
d1rutx130 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 97.51
d1v6ga141 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 97.5
d1j2oa130 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 97.48
d1x4la129 Four and a half LIM domains protein 2, FHL2 {Human 97.48
d2dara132 PDZ and LIM domain protein 5, Enigma {Human (Homo 97.43
d2cura131 Four and a half LIM domains protein 1, FHL-1 {Huma 97.41
d1x68a129 Four and a half LIM domains protein 5, FHL-5 {Huma 97.41
d1x4ka227 Four and a half LIM domains protein 2, FHL2 {Human 97.4
d1b8ta135 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.38
d1ibia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.38
d1wyha227 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.31
d1wyha227 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.24
d1x63a232 Four and a half LIM domains protein 1, FHL-1 {Huma 97.21
d1x4la129 Four and a half LIM domains protein 2, FHL2 {Human 97.21
d1x4ka132 Four and a half LIM domains protein 2, FHL2 {Human 97.19
d1a7ia232 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.17
d1wyha132 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.16
d1x4ka227 Four and a half LIM domains protein 2, FHL2 {Human 97.15
d1b8ta135 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.15
d2cupa327 Four and a half LIM domains protein 1, FHL-1 {Huma 97.14
d1rutx331 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 97.11
d1a7ia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.06
d1a7ia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.03
d1a7ia232 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.02
d1x68a129 Four and a half LIM domains protein 5, FHL-5 {Huma 96.94
d1x61a127 Thyroid receptor interacting protein 6, TRIP6 {Hum 96.74
d2cura131 Four and a half LIM domains protein 1, FHL-1 {Huma 96.73
d1x62a235 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 96.72
d1x61a232 Thyroid receptor interacting protein 6, TRIP6 {Hum 96.7
d1x64a145 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 96.62
d1x62a235 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 96.61
d2dloa233 Thyroid receptor interacting protein 6, TRIP6 {Hum 96.6
d1x6aa134 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 96.59
d1x64a145 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 96.56
d2cupa327 Four and a half LIM domains protein 1, FHL-1 {Huma 96.27
d1wiga241 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 96.25
d1x61a232 Thyroid receptor interacting protein 6, TRIP6 {Hum 95.97
d1x63a232 Four and a half LIM domains protein 1, FHL-1 {Huma 95.91
d1x64a231 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 95.74
d1wiga132 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 95.63
d1wiga132 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 95.48
d1g47a135 Pinch (particularly interesting new Cys-His) prote 95.47
d1x64a231 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 95.23
d1x62a131 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 94.8
d2cupa231 Four and a half LIM domains protein 1, FHL-1 {Huma 94.52
d2cora131 Pinch (particularly interesting new Cys-His) prote 94.18
d1x61a127 Thyroid receptor interacting protein 6, TRIP6 {Hum 93.82
d1x6aa134 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 93.66
d1x62a131 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 93.59
d1g47a135 Pinch (particularly interesting new Cys-His) prote 92.89
d1rutx234 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 92.55
d1wiga241 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 92.26
d2cora131 Pinch (particularly interesting new Cys-His) prote 92.09
d2d8xa132 Pinch (particularly interesting new Cys-His) prote 91.97
d1rutx433 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 91.63
d2cora235 Pinch (particularly interesting new Cys-His) prote 91.58
d1x6aa234 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 91.43
d1rutx433 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 90.61
d2cupa231 Four and a half LIM domains protein 1, FHL-1 {Huma 87.82
d1x68a234 Four and a half LIM domains protein 5, FHL-5 {Huma 87.24
d2cora235 Pinch (particularly interesting new Cys-His) prote 87.08
d1x6aa234 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 86.71
d2d8xa132 Pinch (particularly interesting new Cys-His) prote 80.64
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: LIM domain
domain: Cysteine-rich (intestinal) protein, CRP, CRIP
species: Chicken (Gallus gallus) [TaxId: 9031]
Probab=99.23  E-value=8.6e-13  Score=85.10  Aligned_cols=48  Identities=63%  Similarity=1.259  Sum_probs=45.2

Q ss_pred             cccccCCCCCCCCCccCCCCccccccccccccCCCccccCCCCCccccC
Q psy12252        308 SCADCHRSLDSTNLNDGPDNDIYCRGCYGKNFGPKGCGFGLGAGALTMA  356 (356)
Q Consensus       308 ~C~~C~~~L~~~~~~~~~~g~~yC~~c~~~~f~~~~~~~~~~~~~~~~~  356 (356)
                      +|..|++.|++.... ++|++|||+.||.++||||+++++++||+|.++
T Consensus         1 KC~~C~k~Lds~t~~-ehdg~~YCk~CY~k~fGPKG~g~G~gaG~l~~~   48 (49)
T d1b8ta4           1 RCAKCGKSLESTTLA-DKDGEIYCKGCYAKNFGPKGFGFGQGAGALIHS   48 (49)
T ss_dssp             BCTTTCCBCCSSSEE-EETTEEEEHHHHHHHTCCCCCCCCCCCCCCCCC
T ss_pred             ChhhcCCccCCCccc-ccCCcccchhhhhhccCCCccCcccCccccccc
Confidence            699999999999877 599999999999999999999999999999875



>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure