Psyllid ID: psy12252
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 356 | ||||||
| 92109966 | 505 | IP07084p [Drosophila melanogaster] | 0.921 | 0.649 | 0.511 | 7e-95 | |
| 242019568 | 492 | muscle lim protein, putative [Pediculus | 0.929 | 0.672 | 0.493 | 1e-94 | |
| 221468537 | 486 | muscle LIM protein at 60A, isoform B [Dr | 0.907 | 0.664 | 0.515 | 4e-94 | |
| 157114447 | 488 | muscle lim protein [Aedes aegypti] gi|10 | 0.938 | 0.684 | 0.465 | 4e-87 | |
| 195036714 | 492 | GH18591 [Drosophila grimshawi] gi|193894 | 0.755 | 0.546 | 0.520 | 8e-86 | |
| 289742311 | 491 | muscle LIM protein at 84B [Glossina mors | 0.766 | 0.556 | 0.523 | 2e-85 | |
| 17137134 | 495 | muscle LIM protein at 84B, isoform A [Dr | 0.755 | 0.543 | 0.523 | 3e-85 | |
| 195392002 | 491 | GJ22693 [Drosophila virilis] gi|19415273 | 0.755 | 0.547 | 0.523 | 3e-85 | |
| 193718315 | 496 | PREDICTED: muscle LIM protein Mlp84B-lik | 0.764 | 0.548 | 0.519 | 3e-85 | |
| 328788697 | 493 | PREDICTED: muscle LIM protein Mlp84B-lik | 0.764 | 0.551 | 0.513 | 4e-85 |
| >gi|92109966|gb|ABE73307.1| IP07084p [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
Score = 353 bits (906), Expect = 7e-95, Method: Compositional matrix adjust.
Identities = 203/397 (51%), Positives = 249/397 (62%), Gaps = 69/397 (17%)
Query: 9 KLDIIMPFVPAENPKCPACGKSVYAAEERVAGGYKFHKMCFKCSMCSKFLDSTNCTEHEK 68
+ I MPFVP E PKCPACGKSVYAAEERVAGGYKFHK CFKCSMC+K LDSTNCTEHEK
Sbjct: 15 RTQIKMPFVPVETPKCPACGKSVYAAEERVAGGYKFHKTCFKCSMCNKALDSTNCTEHEK 74
Query: 69 ELYCRQCHGRKYGPKGYGFGGGAGCLSMDAG----------------------------- 99
EL+C+ CHGRKYGPKGYGFGGGAGCLS D G
Sbjct: 75 ELFCKNCHGRKYGPKGYGFGGGAGCLSTDTGAHLNREFVPPKIPPKAPDGLGCPRCGIYV 134
Query: 100 ---------------------MCSKFLDST-NCTEHEKELYCRQCHGRKYGPKGYGFGG- 136
C+K LDST +C +K++YCR C+ +K+G +GYG G
Sbjct: 135 YAAEQMLARGKGYHRRCFKCVQCNKTLDSTLHCDGPDKDIYCRGCYAQKFGARGYGHIGI 194
Query: 137 -GAGCLSMDAGEHLTENNAPRTTVIDTAKIKAAPGKGCPRCGGVVFAAEQVLAKGSEWHR 195
G +S + AP+ ++I+ +I+A G+GCPRCGGVVFAAEQVL+KG WHR
Sbjct: 195 SSLGLMSDIRDSEWQSDMAPKASIINVEQIQAPIGEGCPRCGGVVFAAEQVLSKGRSWHR 254
Query: 196 KCFKCRDCNKTLDSINACDGPDKDIYCKTCYGKKHKYCKACYGKNFGPKGFGYGHSPTLV 255
KCFKCRDC KTLDSI ACDGPD ++YCKTCYGKK +GP G+G+ + +
Sbjct: 255 KCFKCRDCTKTLDSIIACDGPDNEVYCKTCYGKK-----------WGPHGYGFACGSSFL 303
Query: 256 STSGESTMQFYDARP-----TSGLKGRNGDGCPRCGFVVYAAEQMISKNRIWHRRCFSCA 310
T G + RP T+ + +G+GCPRCG V+AAE +SK +++HR+CF+CA
Sbjct: 304 QTDGITEENLASERPFVAPDTTSIMAPDGEGCPRCGGAVFAAELQLSKGKMYHRKCFNCA 363
Query: 311 DCHRSLDSTNLNDGPDNDIYCRGCYGKNFGPKGCGFG 347
C R LDS DGPD++IYC+ CY K FGPKG G+G
Sbjct: 364 RCTRPLDSVLACDGPDDNIYCKLCYAKLFGPKGVGYG 400
|
Source: Drosophila melanogaster Species: Drosophila melanogaster Genus: Drosophila Family: Drosophilidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|242019568|ref|XP_002430232.1| muscle lim protein, putative [Pediculus humanus corporis] gi|212515332|gb|EEB17494.1| muscle lim protein, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|221468537|ref|NP_001137750.1| muscle LIM protein at 60A, isoform B [Drosophila melanogaster] gi|220902371|gb|ACL83203.1| muscle LIM protein at 60A, isoform B [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|157114447|ref|XP_001652275.1| muscle lim protein [Aedes aegypti] gi|108877265|gb|EAT41490.1| AAEL006866-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|195036714|ref|XP_001989813.1| GH18591 [Drosophila grimshawi] gi|193894009|gb|EDV92875.1| GH18591 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|289742311|gb|ADD19903.1| muscle LIM protein at 84B [Glossina morsitans morsitans] | Back alignment and taxonomy information |
|---|
| >gi|17137134|ref|NP_477122.1| muscle LIM protein at 84B, isoform A [Drosophila melanogaster] gi|24644746|ref|NP_731134.1| muscle LIM protein at 84B, isoform B [Drosophila melanogaster] gi|195498856|ref|XP_002096704.1| GE25818 [Drosophila yakuba] gi|2497676|sp|Q24400.1|MLP2_DROME RecName: Full=Muscle LIM protein Mlp84B gi|987834|emb|CAA62627.1| muscle LIM protein [Drosophila melanogaster] gi|3659881|gb|AAC61591.1| muscle LIM protein at 84B [Drosophila melanogaster] gi|7298855|gb|AAF54063.1| muscle LIM protein at 84B, isoform A [Drosophila melanogaster] gi|7298856|gb|AAF54064.1| muscle LIM protein at 84B, isoform B [Drosophila melanogaster] gi|27819817|gb|AAO24957.1| RE40142p [Drosophila melanogaster] gi|194182805|gb|EDW96416.1| GE25818 [Drosophila yakuba] gi|220942504|gb|ACL83795.1| Mlp84B-PA [synthetic construct] gi|220952718|gb|ACL88902.1| Mlp84B-PA [synthetic construct] | Back alignment and taxonomy information |
|---|
| >gi|195392002|ref|XP_002054648.1| GJ22693 [Drosophila virilis] gi|194152734|gb|EDW68168.1| GJ22693 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|193718315|ref|XP_001950563.1| PREDICTED: muscle LIM protein Mlp84B-like isoform 1 [Acyrthosiphon pisum] gi|328708622|ref|XP_003243749.1| PREDICTED: muscle LIM protein Mlp84B-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328788697|ref|XP_394758.3| PREDICTED: muscle LIM protein Mlp84B-like isoform 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 356 | ||||||
| FB|FBgn0014863 | 495 | Mlp84B "Muscle LIM protein at | 0.674 | 0.484 | 0.585 | 1.2e-108 | |
| UNIPROTKB|F1NMV9 | 194 | CSRP1 "Cysteine and glycine-ri | 0.480 | 0.881 | 0.482 | 1.4e-41 | |
| UNIPROTKB|P67966 | 192 | CSRP1 "Cysteine and glycine-ri | 0.480 | 0.890 | 0.482 | 1.4e-41 | |
| UNIPROTKB|Q3MHY1 | 193 | CSRP1 "Cysteine and glycine-ri | 0.477 | 0.880 | 0.461 | 1.3e-38 | |
| MGI|MGI:88549 | 193 | Csrp1 "cysteine and glycine-ri | 0.477 | 0.880 | 0.456 | 1.6e-38 | |
| UNIPROTKB|P21291 | 193 | CSRP1 "Cysteine and glycine-ri | 0.477 | 0.880 | 0.456 | 1.6e-38 | |
| RGD|62053 | 193 | Csrp1 "cysteine and glycine-ri | 0.477 | 0.880 | 0.456 | 2.6e-38 | |
| UNIPROTKB|J9NYN2 | 193 | CSRP1 "Uncharacterized protein | 0.477 | 0.880 | 0.456 | 3.4e-38 | |
| UNIPROTKB|I3LL97 | 193 | CSRP1 "Uncharacterized protein | 0.477 | 0.880 | 0.456 | 3.4e-38 | |
| UNIPROTKB|F1RYJ8 | 193 | CSRP2 "Uncharacterized protein | 0.488 | 0.901 | 0.437 | 8.9e-38 |
| FB|FBgn0014863 Mlp84B "Muscle LIM protein at 84B" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 794 (284.6 bits), Expect = 1.2e-108, Sum P(2) = 1.2e-108
Identities = 150/256 (58%), Positives = 175/256 (68%)
Query: 101 CSKFLDSTNCTEH-EKELYCRQCHXXXXXXXXXXXXXXXXCLSMDA-GEHLTENNAPRTT 158
C K LDS N ++ ++++YCR C+ L D E N P
Sbjct: 252 CHKTLDSINASDGPDRDVYCRTCYGKKWGPHGYGFACGSGFLQTDGLTEDQISANRPFYN 311
Query: 159 VIDTAKIKAAPGKGCPRCGGVVFAAEQVLAKGSEWHRKCFKCRDCNKTLDSINACDGPDK 218
DT IKA G+GCPRCGG VFAAEQ L+KG WH+KC+ C DC++ LDS+ ACDGPD
Sbjct: 312 P-DTTSIKARDGEGCPRCGGAVFAAEQQLSKGKVWHKKCYNCADCHRPLDSVLACDGPDG 370
Query: 219 DIYCKTCYGKKHKYCKACYGKNFGPKGFGYGHSPTLVSTSGESTMQFYDARPTSGLKGRN 278
DI+C+ ACYGK FGPKGFGYGH+PTLVSTSGEST+QF D RP +G K
Sbjct: 371 DIHCR-----------ACYGKLFGPKGFGYGHAPTLVSTSGESTIQFPDGRPLAGPK--T 417
Query: 279 GDGCPRCGFVVYAAEQMISKNRIWHRRCFSCADCHRSLDSTNLNDGPDNDIYCRGCYGKN 338
GCPRCGF V+AAEQMISK RIWH+RCF C+DC +SLDSTNLNDGPD DIYCR CYG+N
Sbjct: 418 SGGCPRCGFAVFAAEQMISKTRIWHKRCFYCSDCRKSLDSTNLNDGPDGDIYCRACYGRN 477
Query: 339 FGPKGCGFGLGAGALT 354
FGPKG G+GLGAGALT
Sbjct: 478 FGPKGVGYGLGAGALT 493
|
|
| UNIPROTKB|F1NMV9 CSRP1 "Cysteine and glycine-rich protein 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P67966 CSRP1 "Cysteine and glycine-rich protein 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3MHY1 CSRP1 "Cysteine and glycine-rich protein 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:88549 Csrp1 "cysteine and glycine-rich protein 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P21291 CSRP1 "Cysteine and glycine-rich protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|62053 Csrp1 "cysteine and glycine-rich protein 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NYN2 CSRP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LL97 CSRP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RYJ8 CSRP2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 356 | |||
| cd09404 | 54 | cd09404, LIM1_MLP84B_like, The LIM domain of Mlp84 | 3e-26 | |
| cd09326 | 53 | cd09326, LIM_CRP_like, The LIM domains of Cysteine | 3e-21 | |
| cd09326 | 53 | cd09326, LIM_CRP_like, The LIM domains of Cysteine | 6e-19 | |
| cd09326 | 53 | cd09326, LIM_CRP_like, The LIM domains of Cysteine | 9e-19 | |
| cd09482 | 54 | cd09482, LIM2_CRP3, The second LIM domain of Cyste | 7e-13 | |
| cd09404 | 54 | cd09404, LIM1_MLP84B_like, The LIM domain of Mlp84 | 2e-12 | |
| cd09403 | 54 | cd09403, LIM2_CRP, The second LIM domain of Cystei | 3e-12 | |
| cd09403 | 54 | cd09403, LIM2_CRP, The second LIM domain of Cystei | 5e-12 | |
| pfam00412 | 58 | pfam00412, LIM, LIM domain | 2e-11 | |
| cd09401 | 53 | cd09401, LIM_TLP_like, The LIM domains of thymus L | 2e-11 | |
| cd09481 | 54 | cd09481, LIM1_CRP3, The first LIM domain of Cystei | 4e-11 | |
| cd09403 | 54 | cd09403, LIM2_CRP, The second LIM domain of Cystei | 5e-11 | |
| cd09482 | 54 | cd09482, LIM2_CRP3, The second LIM domain of Cyste | 6e-11 | |
| cd09840 | 54 | cd09840, LIM2_CRP2, The second LIM domain of Cyste | 7e-11 | |
| cd09482 | 54 | cd09482, LIM2_CRP3, The second LIM domain of Cyste | 2e-10 | |
| cd09480 | 55 | cd09480, LIM1_CRP2, The first LIM domain of Cystei | 2e-10 | |
| cd09358 | 53 | cd09358, LIM_Mical_like, The LIM domain of Mical ( | 3e-10 | |
| cd09404 | 54 | cd09404, LIM1_MLP84B_like, The LIM domain of Mlp84 | 4e-10 | |
| cd09840 | 54 | cd09840, LIM2_CRP2, The second LIM domain of Cyste | 4e-10 | |
| cd09402 | 53 | cd09402, LIM1_CRP, The first LIM domain of Cystein | 4e-10 | |
| cd09479 | 56 | cd09479, LIM1_CRP1, The first LIM domain of Cystei | 4e-10 | |
| cd09840 | 54 | cd09840, LIM2_CRP2, The second LIM domain of Cyste | 2e-09 | |
| cd09401 | 53 | cd09401, LIM_TLP_like, The LIM domains of thymus L | 3e-09 | |
| smart00132 | 54 | smart00132, LIM, Zinc-binding domain present in Li | 3e-08 | |
| cd08368 | 53 | cd08368, LIM, LIM is a small protein-protein inter | 6e-08 | |
| cd09445 | 53 | cd09445, LIM_Mical_like_2, This domain belongs to | 9e-08 | |
| cd09440 | 63 | cd09440, LIM1_SF3, The first Lim domain of pollen | 1e-07 | |
| cd09358 | 53 | cd09358, LIM_Mical_like, The LIM domain of Mical ( | 2e-07 | |
| cd09445 | 53 | cd09445, LIM_Mical_like_2, This domain belongs to | 3e-07 | |
| cd09401 | 53 | cd09401, LIM_TLP_like, The LIM domains of thymus L | 5e-07 | |
| cd09478 | 54 | cd09478, LIM_CRIP, The LIM domain of Cysteine-Rich | 6e-07 | |
| cd09441 | 61 | cd09441, LIM2_SF3, The second Lim domain of pollen | 7e-07 | |
| cd09443 | 55 | cd09443, LIM_Ltd-1, The LIM domain of LIM and tran | 7e-07 | |
| cd09400 | 61 | cd09400, LIM_like_1, LIM domain in proteins of unk | 1e-06 | |
| cd09480 | 55 | cd09480, LIM1_CRP2, The first LIM domain of Cystei | 2e-06 | |
| smart00132 | 54 | smart00132, LIM, Zinc-binding domain present in Li | 3e-06 | |
| cd09402 | 53 | cd09402, LIM1_CRP, The first LIM domain of Cystein | 4e-06 | |
| cd09479 | 56 | cd09479, LIM1_CRP1, The first LIM domain of Cystei | 4e-06 | |
| cd08368 | 53 | cd08368, LIM, LIM is a small protein-protein inter | 6e-06 | |
| cd09477 | 54 | cd09477, LIM2_TLP, The second LIM domain of thymus | 6e-06 | |
| pfam00412 | 58 | pfam00412, LIM, LIM domain | 8e-06 | |
| cd09443 | 55 | cd09443, LIM_Ltd-1, The LIM domain of LIM and tran | 9e-06 | |
| pfam00412 | 58 | pfam00412, LIM, LIM domain | 1e-05 | |
| cd09480 | 55 | cd09480, LIM1_CRP2, The first LIM domain of Cystei | 1e-05 | |
| cd09445 | 53 | cd09445, LIM_Mical_like_2, This domain belongs to | 1e-05 | |
| cd09481 | 54 | cd09481, LIM1_CRP3, The first LIM domain of Cystei | 2e-05 | |
| cd08368 | 53 | cd08368, LIM, LIM is a small protein-protein inter | 2e-05 | |
| cd09476 | 54 | cd09476, LIM1_TLP, The first LIM domain of thymus | 2e-05 | |
| cd09358 | 53 | cd09358, LIM_Mical_like, The LIM domain of Mical ( | 3e-05 | |
| cd09478 | 54 | cd09478, LIM_CRIP, The LIM domain of Cysteine-Rich | 3e-05 | |
| cd09477 | 54 | cd09477, LIM2_TLP, The second LIM domain of thymus | 3e-05 | |
| cd09476 | 54 | cd09476, LIM1_TLP, The first LIM domain of thymus | 3e-05 | |
| cd09481 | 54 | cd09481, LIM1_CRP3, The first LIM domain of Cystei | 4e-05 | |
| cd09402 | 53 | cd09402, LIM1_CRP, The first LIM domain of Cystein | 4e-05 | |
| cd09400 | 61 | cd09400, LIM_like_1, LIM domain in proteins of unk | 4e-05 | |
| smart00132 | 54 | smart00132, LIM, Zinc-binding domain present in Li | 5e-05 | |
| cd09470 | 54 | cd09470, LIM1_Lhx9, The first LIM domain of Lhx9 | 5e-05 | |
| cd09479 | 56 | cd09479, LIM1_CRP1, The first LIM domain of Cystei | 8e-05 | |
| cd09400 | 61 | cd09400, LIM_like_1, LIM domain in proteins of unk | 1e-04 | |
| cd09469 | 64 | cd09469, LIM1_Lhx2, The first LIM domain of Lhx2 | 1e-04 | |
| cd09446 | 53 | cd09446, LIM_N_RAP, The LIM domain of N-RAP | 1e-04 | |
| cd09447 | 53 | cd09447, LIM_LASP, The LIM domain of LIM and SH3 P | 1e-04 | |
| cd09477 | 54 | cd09477, LIM2_TLP, The second LIM domain of thymus | 2e-04 | |
| cd09447 | 53 | cd09447, LIM_LASP, The LIM domain of LIM and SH3 P | 2e-04 | |
| cd09359 | 53 | cd09359, LIM_LASP_like, The LIM domain of LIM and | 2e-04 | |
| cd09359 | 53 | cd09359, LIM_LASP_like, The LIM domain of LIM and | 3e-04 | |
| cd09349 | 87 | cd09349, LIM1_Zyxin, The first LIM domain of Zyxin | 3e-04 | |
| cd09369 | 54 | cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of L | 3e-04 | |
| cd09359 | 53 | cd09359, LIM_LASP_like, The LIM domain of LIM and | 4e-04 | |
| cd09485 | 53 | cd09485, LIM_Eplin_alpha_beta, The Lim domain of E | 5e-04 | |
| cd09443 | 55 | cd09443, LIM_Ltd-1, The LIM domain of LIM and tran | 7e-04 | |
| cd09446 | 53 | cd09446, LIM_N_RAP, The LIM domain of N-RAP | 9e-04 | |
| cd09440 | 63 | cd09440, LIM1_SF3, The first Lim domain of pollen | 0.001 | |
| cd09442 | 53 | cd09442, LIM_Eplin_like, The Lim domain of Epithel | 0.001 | |
| cd09475 | 59 | cd09475, LIM2_Lhx9, The second LIM domain of Lhx9 | 0.002 | |
| cd09475 | 59 | cd09475, LIM2_Lhx9, The second LIM domain of Lhx9 | 0.002 | |
| cd09476 | 54 | cd09476, LIM1_TLP, The first LIM domain of thymus | 0.004 | |
| cd09446 | 53 | cd09446, LIM_N_RAP, The LIM domain of N-RAP | 0.004 | |
| cd09364 | 53 | cd09364, LIM1_LIMK, The first LIM domain of LIMK ( | 0.004 | |
| cd09393 | 56 | cd09393, LIM3_Lrg1p_like, The third LIM domain of | 0.004 |
| >gnl|CDD|188788 cd09404, LIM1_MLP84B_like, The LIM domain of Mlp84B and Mlp60A | Back alignment and domain information |
|---|
Score = 98.7 bits (246), Expect = 3e-26
Identities = 45/54 (83%), Positives = 49/54 (90%)
Query: 23 KCPACGKSVYAAEERVAGGYKFHKMCFKCSMCSKFLDSTNCTEHEKELYCRQCH 76
KCP CGKSVYAAEER+AGGYK+HKMCFKC MC+K LDSTNC EHE ELYC+QCH
Sbjct: 1 KCPKCGKSVYAAEERLAGGYKWHKMCFKCGMCNKLLDSTNCAEHEGELYCKQCH 54
|
The LIM domain of Mlp84B and Mlp60A: Mlp84B and Mlp60A belong to the CRP LIM domain protein family. The Mlp84B protein contains five copies of the LIM domains, each followed by a Glycin Rich Region (GRR). However, only the first LIM domain of Mlp84B is in this family. Mlp60A exhibits only one LIM domain linked to a glycin-rich region. Mlp84B and Mlp60A are muscle specific proteins and have been implicated in muscle differentiation. While Mlp84B transcripts are enriched at the terminal ends of muscle fibers, Mlp60A transcripts are found throughout the muscle fibers. All LIM domains are 50-60 amino acids in size and share two characteristic zinc finger motifs. The two zinc fingers contain eight conserved residues, mostly cysteines and histidines, which coordinately bond to two zinc atoms. LIM domains function as adaptors or scaffolds to support the assembly of multimeric protein complexes. Length = 54 |
| >gnl|CDD|188712 cd09326, LIM_CRP_like, The LIM domains of Cysteine Rich Protein (CRP) family | Back alignment and domain information |
|---|
| >gnl|CDD|188712 cd09326, LIM_CRP_like, The LIM domains of Cysteine Rich Protein (CRP) family | Back alignment and domain information |
|---|
| >gnl|CDD|188712 cd09326, LIM_CRP_like, The LIM domains of Cysteine Rich Protein (CRP) family | Back alignment and domain information |
|---|
| >gnl|CDD|188866 cd09482, LIM2_CRP3, The second LIM domain of Cysteine Rich Protein 3 (CRP3/MLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188788 cd09404, LIM1_MLP84B_like, The LIM domain of Mlp84B and Mlp60A | Back alignment and domain information |
|---|
| >gnl|CDD|188787 cd09403, LIM2_CRP, The second LIM domain of Cysteine Rich Protein (CRP) | Back alignment and domain information |
|---|
| >gnl|CDD|188787 cd09403, LIM2_CRP, The second LIM domain of Cysteine Rich Protein (CRP) | Back alignment and domain information |
|---|
| >gnl|CDD|215907 pfam00412, LIM, LIM domain | Back alignment and domain information |
|---|
| >gnl|CDD|188785 cd09401, LIM_TLP_like, The LIM domains of thymus LIM protein (TLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188865 cd09481, LIM1_CRP3, The first LIM domain of Cysteine Rich Protein 3 (CRP3/MLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188787 cd09403, LIM2_CRP, The second LIM domain of Cysteine Rich Protein (CRP) | Back alignment and domain information |
|---|
| >gnl|CDD|188866 cd09482, LIM2_CRP3, The second LIM domain of Cysteine Rich Protein 3 (CRP3/MLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188871 cd09840, LIM2_CRP2, The second LIM domain of Cysteine Rich Protein 2 (CRP2) | Back alignment and domain information |
|---|
| >gnl|CDD|188866 cd09482, LIM2_CRP3, The second LIM domain of Cysteine Rich Protein 3 (CRP3/MLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188864 cd09480, LIM1_CRP2, The first LIM domain of Cysteine Rich Protein 2 (CRP2) | Back alignment and domain information |
|---|
| >gnl|CDD|188744 cd09358, LIM_Mical_like, The LIM domain of Mical (molecule interacting with CasL) like family | Back alignment and domain information |
|---|
| >gnl|CDD|188788 cd09404, LIM1_MLP84B_like, The LIM domain of Mlp84B and Mlp60A | Back alignment and domain information |
|---|
| >gnl|CDD|188871 cd09840, LIM2_CRP2, The second LIM domain of Cysteine Rich Protein 2 (CRP2) | Back alignment and domain information |
|---|
| >gnl|CDD|188786 cd09402, LIM1_CRP, The first LIM domain of Cysteine Rich Protein (CRP) | Back alignment and domain information |
|---|
| >gnl|CDD|188863 cd09479, LIM1_CRP1, The first LIM domain of Cysteine Rich Protein 1 (CRP1) | Back alignment and domain information |
|---|
| >gnl|CDD|188871 cd09840, LIM2_CRP2, The second LIM domain of Cysteine Rich Protein 2 (CRP2) | Back alignment and domain information |
|---|
| >gnl|CDD|188785 cd09401, LIM_TLP_like, The LIM domains of thymus LIM protein (TLP) | Back alignment and domain information |
|---|
| >gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|188829 cd09445, LIM_Mical_like_2, This domain belongs to the LIM domain family which are found on Mical (molecule interacting with CasL) like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188824 cd09440, LIM1_SF3, The first Lim domain of pollen specific protein SF3 | Back alignment and domain information |
|---|
| >gnl|CDD|188744 cd09358, LIM_Mical_like, The LIM domain of Mical (molecule interacting with CasL) like family | Back alignment and domain information |
|---|
| >gnl|CDD|188829 cd09445, LIM_Mical_like_2, This domain belongs to the LIM domain family which are found on Mical (molecule interacting with CasL) like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188785 cd09401, LIM_TLP_like, The LIM domains of thymus LIM protein (TLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188862 cd09478, LIM_CRIP, The LIM domain of Cysteine-Rich Intestinal Protein (CRIP) | Back alignment and domain information |
|---|
| >gnl|CDD|188825 cd09441, LIM2_SF3, The second Lim domain of pollen specific protein SF3 | Back alignment and domain information |
|---|
| >gnl|CDD|188827 cd09443, LIM_Ltd-1, The LIM domain of LIM and transglutaminase domains protein (Ltd-1) | Back alignment and domain information |
|---|
| >gnl|CDD|188784 cd09400, LIM_like_1, LIM domain in proteins of unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|188864 cd09480, LIM1_CRP2, The first LIM domain of Cysteine Rich Protein 2 (CRP2) | Back alignment and domain information |
|---|
| >gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >gnl|CDD|188786 cd09402, LIM1_CRP, The first LIM domain of Cysteine Rich Protein (CRP) | Back alignment and domain information |
|---|
| >gnl|CDD|188863 cd09479, LIM1_CRP1, The first LIM domain of Cysteine Rich Protein 1 (CRP1) | Back alignment and domain information |
|---|
| >gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|188861 cd09477, LIM2_TLP, The second LIM domain of thymus LIM protein (TLP) | Back alignment and domain information |
|---|
| >gnl|CDD|215907 pfam00412, LIM, LIM domain | Back alignment and domain information |
|---|
| >gnl|CDD|188827 cd09443, LIM_Ltd-1, The LIM domain of LIM and transglutaminase domains protein (Ltd-1) | Back alignment and domain information |
|---|
| >gnl|CDD|215907 pfam00412, LIM, LIM domain | Back alignment and domain information |
|---|
| >gnl|CDD|188864 cd09480, LIM1_CRP2, The first LIM domain of Cysteine Rich Protein 2 (CRP2) | Back alignment and domain information |
|---|
| >gnl|CDD|188829 cd09445, LIM_Mical_like_2, This domain belongs to the LIM domain family which are found on Mical (molecule interacting with CasL) like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188865 cd09481, LIM1_CRP3, The first LIM domain of Cysteine Rich Protein 3 (CRP3/MLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|188860 cd09476, LIM1_TLP, The first LIM domain of thymus LIM protein (TLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188744 cd09358, LIM_Mical_like, The LIM domain of Mical (molecule interacting with CasL) like family | Back alignment and domain information |
|---|
| >gnl|CDD|188862 cd09478, LIM_CRIP, The LIM domain of Cysteine-Rich Intestinal Protein (CRIP) | Back alignment and domain information |
|---|
| >gnl|CDD|188861 cd09477, LIM2_TLP, The second LIM domain of thymus LIM protein (TLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188860 cd09476, LIM1_TLP, The first LIM domain of thymus LIM protein (TLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188865 cd09481, LIM1_CRP3, The first LIM domain of Cysteine Rich Protein 3 (CRP3/MLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188786 cd09402, LIM1_CRP, The first LIM domain of Cysteine Rich Protein (CRP) | Back alignment and domain information |
|---|
| >gnl|CDD|188784 cd09400, LIM_like_1, LIM domain in proteins of unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >gnl|CDD|188854 cd09470, LIM1_Lhx9, The first LIM domain of Lhx9 | Back alignment and domain information |
|---|
| >gnl|CDD|188863 cd09479, LIM1_CRP1, The first LIM domain of Cysteine Rich Protein 1 (CRP1) | Back alignment and domain information |
|---|
| >gnl|CDD|188784 cd09400, LIM_like_1, LIM domain in proteins of unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|188853 cd09469, LIM1_Lhx2, The first LIM domain of Lhx2 | Back alignment and domain information |
|---|
| >gnl|CDD|188830 cd09446, LIM_N_RAP, The LIM domain of N-RAP | Back alignment and domain information |
|---|
| >gnl|CDD|188831 cd09447, LIM_LASP, The LIM domain of LIM and SH3 Protein (LASP) | Back alignment and domain information |
|---|
| >gnl|CDD|188861 cd09477, LIM2_TLP, The second LIM domain of thymus LIM protein (TLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188831 cd09447, LIM_LASP, The LIM domain of LIM and SH3 Protein (LASP) | Back alignment and domain information |
|---|
| >gnl|CDD|188745 cd09359, LIM_LASP_like, The LIM domain of LIM and SH3 Protein (LASP)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188745 cd09359, LIM_LASP_like, The LIM domain of LIM and SH3 Protein (LASP)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188735 cd09349, LIM1_Zyxin, The first LIM domain of Zyxin | Back alignment and domain information |
|---|
| >gnl|CDD|188755 cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of Lhx2 and Lhx9 family | Back alignment and domain information |
|---|
| >gnl|CDD|188745 cd09359, LIM_LASP_like, The LIM domain of LIM and SH3 Protein (LASP)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188869 cd09485, LIM_Eplin_alpha_beta, The Lim domain of Epithelial Protein Lost in Neoplasm (Eplin) | Back alignment and domain information |
|---|
| >gnl|CDD|188827 cd09443, LIM_Ltd-1, The LIM domain of LIM and transglutaminase domains protein (Ltd-1) | Back alignment and domain information |
|---|
| >gnl|CDD|188830 cd09446, LIM_N_RAP, The LIM domain of N-RAP | Back alignment and domain information |
|---|
| >gnl|CDD|188824 cd09440, LIM1_SF3, The first Lim domain of pollen specific protein SF3 | Back alignment and domain information |
|---|
| >gnl|CDD|188826 cd09442, LIM_Eplin_like, The Lim domain of Epithelial Protein Lost in Neoplasm (Eplin) like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188859 cd09475, LIM2_Lhx9, The second LIM domain of Lhx9 | Back alignment and domain information |
|---|
| >gnl|CDD|188859 cd09475, LIM2_Lhx9, The second LIM domain of Lhx9 | Back alignment and domain information |
|---|
| >gnl|CDD|188860 cd09476, LIM1_TLP, The first LIM domain of thymus LIM protein (TLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188830 cd09446, LIM_N_RAP, The LIM domain of N-RAP | Back alignment and domain information |
|---|
| >gnl|CDD|188750 cd09364, LIM1_LIMK, The first LIM domain of LIMK (LIM domain Kinase ) | Back alignment and domain information |
|---|
| >gnl|CDD|188779 cd09393, LIM3_Lrg1p_like, The third LIM domain of Lrg1p, a LIM and RhoGap domain containing protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 356 | |||
| KOG2272|consensus | 332 | 99.98 | ||
| KOG1701|consensus | 468 | 99.97 | ||
| KOG1044|consensus | 670 | 99.89 | ||
| KOG2272|consensus | 332 | 99.89 | ||
| KOG1703|consensus | 479 | 99.88 | ||
| KOG1701|consensus | 468 | 99.85 | ||
| KOG1703|consensus | 479 | 99.73 | ||
| KOG4577|consensus | 383 | 99.71 | ||
| KOG4577|consensus | 383 | 99.71 | ||
| KOG1044|consensus | 670 | 99.64 | ||
| KOG1700|consensus | 200 | 99.48 | ||
| PF00412 | 58 | LIM: LIM domain; InterPro: IPR001781 Zinc finger ( | 99.46 | |
| PF00412 | 58 | LIM: LIM domain; InterPro: IPR001781 Zinc finger ( | 99.4 | |
| KOG1700|consensus | 200 | 99.36 | ||
| smart00132 | 39 | LIM Zinc-binding domain present in Lin-11, Isl-1, | 98.6 | |
| smart00132 | 39 | LIM Zinc-binding domain present in Lin-11, Isl-1, | 98.55 | |
| KOG1702|consensus | 264 | 97.61 | ||
| KOG1702|consensus | 264 | 97.34 | ||
| KOG0490|consensus | 235 | 96.37 | ||
| KOG0490|consensus | 235 | 95.88 | ||
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 88.82 | |
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 84.88 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 82.35 |
| >KOG2272|consensus | Back alignment and domain information |
|---|
Probab=99.98 E-value=8.8e-36 Score=259.82 Aligned_cols=270 Identities=22% Similarity=0.423 Sum_probs=212.3
Q ss_pred CCCCCCCCCCCCCccccceEEE-eCCceeccCCcccccccccccCCCccccCCcccCccccccccCCCCCccCC---Ccc
Q psy12252 17 VPAENPKCPACGKSVYAAEERV-AGGYKFHKMCFKCSMCSKFLDSTNCTEHEKELYCRQCHGRKYGPKGYGFGG---GAG 92 (356)
Q Consensus 17 ~~~~~~~C~~C~~~I~~~~~i~-~~~~~~H~~CF~C~~C~~~L~~~~~~~~~g~~yC~~cy~~~~~~~c~~c~~---~~~ 92 (356)
+..++..|..|......++.++ .+|..||..||.|+.|-.||.++.||+.+|+.||+.++..+|+|-|.+|++ +..
T Consensus 8 ~g~~~~~C~RC~~gF~~~e~~vns~ge~wH~~CFvCAQCf~pf~~g~~~efEgRkYCEhDF~~LfaPcC~kC~EFiiGrV 87 (332)
T KOG2272|consen 8 SGLANMVCERCRDGFEPAEKIVNSNGELWHEQCFVCAQCFRPFPDGIFYEFEGRKYCEHDFHVLFAPCCGKCGEFIIGRV 87 (332)
T ss_pred hHHHHHHHHHHhccCCchhhhhccCchhhHHHHHHHHHhcCcCCCceeEEecCcccccccchhhhchhhcccccchhhHH
Confidence 3456678999999998888665 688999999999999999999999999999999999999999999999998 234
Q ss_pred eeeccc---------ccccccCCCCcccccCCceecccCcCcccCCCC--CCCCCCCCcCCCCcccccccC---------
Q psy12252 93 CLSMDA---------GMCSKFLDSTNCTEHEKELYCRQCHGRKYGPKG--YGFGGGAGCLSMDAGEHLTEN--------- 152 (356)
Q Consensus 93 ~~~~~~---------~~c~~~l~~~~~~~~~~~~~C~~c~~~~~~p~~--~~~~~g~~~~~~d~~~~~~~~--------- 152 (356)
+.+|+. ..|++.|.+..|.-..|+..|..|.++.-+..- ..+......+..+...+-+.+
T Consensus 88 ikamnnSwHp~CF~Cd~Cn~~Lad~gf~rnqgr~LC~~Cn~k~Ka~~~g~YvC~KCh~~iD~~~l~fr~d~yH~yHFkCt 167 (332)
T KOG2272|consen 88 IKAMNNSWHPACFRCDLCNKHLADQGFYRNQGRALCRECNQKEKAKGRGRYVCQKCHAHIDEQPLTFRGDPYHPYHFKCT 167 (332)
T ss_pred HHhhccccCcccchhHHHHHHHhhhhhHhhcchHHhhhhhhhhcccccceeehhhhhhhcccccccccCCCCCccceecc
Confidence 555553 388899999999988999999998876321100 000001112222222221111
Q ss_pred -------CCCCc---cccccccccCCCCCCCCCCCceEecceeeccCCCcccccccccccCcCcCCCCccccCCCCceec
Q psy12252 153 -------NAPRT---TVIDTAKIKAAPGKGCPRCGGVVFAAEQVLAKGSEWHRKCFKCRDCNKTLDSINACDGPDKDIYC 222 (356)
Q Consensus 153 -------~~~~~---~~~~~~~~~~~~~~~C~~C~~~I~~~~~i~a~~~~~H~~CF~C~~C~~~l~~~~~~~~~~g~~~C 222 (356)
+..+. .+++..+......++|..|++||. +.+|.++|+.||+++|+|+.|.+|+-+-..+ ++.|..||
T Consensus 168 ~C~keL~sdaRevk~eLyClrChD~mgipiCgaC~rpIe-ervi~amgKhWHveHFvCa~CekPFlGHrHY-EkkGlaYC 245 (332)
T KOG2272|consen 168 TCGKELTSDAREVKGELYCLRCHDKMGIPICGACRRPIE-ERVIFAMGKHWHVEHFVCAKCEKPFLGHRHY-EKKGLAYC 245 (332)
T ss_pred cccccccchhhhhccceeccccccccCCcccccccCchH-HHHHHHhccccchhheeehhcCCcccchhhh-hhcCchhH
Confidence 00000 244455555566789999999997 4567899999999999999999998776654 59999999
Q ss_pred ccccccCCcccccccccccCCCcccCCCCCceeecCCCCccccCCCCCCCCCCCCCCCCCCCCCceeecceEEEeCCccc
Q psy12252 223 KTCYGKKHKYCKACYGKNFGPKGFGYGHSPTLVSTSGESTMQFYDARPTSGLKGRNGDGCPRCGFVVYAAEQMISKNRIW 302 (356)
Q Consensus 223 ~~c~~~~~~~C~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~g~~~~~~~~C~~C~~~I~~~e~v~~~g~~~ 302 (356)
+.+|.++||. .|..|+.+|. |+++.+.++.|
T Consensus 246 -----------e~h~~qLfG~-------------------------------------~CF~C~~~i~-G~vv~al~Kaw 276 (332)
T KOG2272|consen 246 -----------ETHYHQLFGN-------------------------------------LCFICNRVIG-GDVVSALNKAW 276 (332)
T ss_pred -----------HHHHHHHhhh-------------------------------------hheecCCccC-ccHHHHhhhhh
Confidence 8889999985 7999999996 78899999999
Q ss_pred ccCcccccccCCCCCCCCCccCCCCcccccccccc
Q psy12252 303 HRRCFSCADCHRSLDSTNLNDGPDNDIYCRGCYGK 337 (356)
Q Consensus 303 H~~CF~C~~C~~~L~~~~~~~~~~g~~yC~~c~~~ 337 (356)
-++||+|+.|.+.|+..+.+++.|.+|.|++||++
T Consensus 277 Cv~cf~Cs~Cdkkl~~K~Kf~E~DmkP~CKkCy~r 311 (332)
T KOG2272|consen 277 CVECFSCSTCDKKLTQKNKFYEFDMKPVCKKCYDR 311 (332)
T ss_pred ccccccccccccccccccceeeeccchHHHHHHhh
Confidence 99999999999999999877789999999999984
|
|
| >KOG1701|consensus | Back alignment and domain information |
|---|
| >KOG1044|consensus | Back alignment and domain information |
|---|
| >KOG2272|consensus | Back alignment and domain information |
|---|
| >KOG1703|consensus | Back alignment and domain information |
|---|
| >KOG1701|consensus | Back alignment and domain information |
|---|
| >KOG1703|consensus | Back alignment and domain information |
|---|
| >KOG4577|consensus | Back alignment and domain information |
|---|
| >KOG4577|consensus | Back alignment and domain information |
|---|
| >KOG1044|consensus | Back alignment and domain information |
|---|
| >KOG1700|consensus | Back alignment and domain information |
|---|
| >PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1700|consensus | Back alignment and domain information |
|---|
| >smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >KOG1702|consensus | Back alignment and domain information |
|---|
| >KOG1702|consensus | Back alignment and domain information |
|---|
| >KOG0490|consensus | Back alignment and domain information |
|---|
| >KOG0490|consensus | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 356 | ||||
| 1b8t_A | 192 | Solution Structure Of The Chicken Crp1 Length = 192 | 5e-27 | ||
| 1qli_A | 113 | Quail Cysteine And Glycine-Rich Protein, Nmr, 15 Mi | 3e-19 | ||
| 1cxx_A | 113 | Mutant R122a Of Quail Cysteine And Glycine-Rich Pro | 2e-18 | ||
| 1ctl_A | 85 | Structure Of The Carboxy-Terminal Lim Domain From T | 7e-18 | ||
| 2o13_A | 58 | Solution Structure Of The C-Terminal Lim Domain Of | 2e-12 | ||
| 1a7i_A | 81 | Amino-Terminal Lim Domain From Quail Cysteine And G | 2e-12 | ||
| 2o10_A | 60 | Solution Structure Of The N-Terminal Lim Domain Of | 5e-09 | ||
| 2o10_A | 60 | Solution Structure Of The N-Terminal Lim Domain Of | 2e-06 | ||
| 2o10_A | 60 | Solution Structure Of The N-Terminal Lim Domain Of | 6e-06 | ||
| 1iml_A | 76 | Cysteine Rich Intestinal Protein, Nmr, 48 Structure | 1e-07 | ||
| 1iml_A | 76 | Cysteine Rich Intestinal Protein, Nmr, 48 Structure | 1e-05 | ||
| 2cu8_A | 76 | Solution Structure Of The Lim Domain Of Human Cyste | 8e-05 | ||
| 2cu8_A | 76 | Solution Structure Of The Lim Domain Of Human Cyste | 2e-04 |
| >pdb|1B8T|A Chain A, Solution Structure Of The Chicken Crp1 Length = 192 | Back alignment and structure |
|
| >pdb|1QLI|A Chain A, Quail Cysteine And Glycine-Rich Protein, Nmr, Minimized Average Structure Length = 113 | Back alignment and structure |
| >pdb|1CXX|A Chain A, Mutant R122a Of Quail Cysteine And Glycine-Rich Protein, Nmr, Minimized Structure Length = 113 | Back alignment and structure |
| >pdb|1CTL|A Chain A, Structure Of The Carboxy-Terminal Lim Domain From The Cysteine Rich Protein Crp Length = 85 | Back alignment and structure |
| >pdb|2O13|A Chain A, Solution Structure Of The C-Terminal Lim Domain Of MlpCRP3 Length = 58 | Back alignment and structure |
| >pdb|1A7I|A Chain A, Amino-Terminal Lim Domain From Quail Cysteine And Glycine- Rich Protein, Nmr, Minimized Average Structure Length = 81 | Back alignment and structure |
| >pdb|2O10|A Chain A, Solution Structure Of The N-Terminal Lim Domain Of MlpCRP3 Length = 60 | Back alignment and structure |
| >pdb|2O10|A Chain A, Solution Structure Of The N-Terminal Lim Domain Of MlpCRP3 Length = 60 | Back alignment and structure |
| >pdb|2O10|A Chain A, Solution Structure Of The N-Terminal Lim Domain Of MlpCRP3 Length = 60 | Back alignment and structure |
| >pdb|1IML|A Chain A, Cysteine Rich Intestinal Protein, Nmr, 48 Structures Length = 76 | Back alignment and structure |
| >pdb|1IML|A Chain A, Cysteine Rich Intestinal Protein, Nmr, 48 Structures Length = 76 | Back alignment and structure |
| >pdb|2CU8|A Chain A, Solution Structure Of The Lim Domain Of Human Cysteine-Rich Protein 2 Length = 76 | Back alignment and structure |
| >pdb|2CU8|A Chain A, Solution Structure Of The Lim Domain Of Human Cysteine-Rich Protein 2 Length = 76 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 356 | |||
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 8e-36 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 5e-32 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 6e-19 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 7e-24 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 2e-19 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 3e-15 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 2e-22 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 1e-17 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 1e-15 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 3e-21 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 3e-15 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 1e-14 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 3e-19 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 5e-13 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 7e-13 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 4e-14 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 3e-10 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 6e-09 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 3e-13 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 2e-11 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 3e-11 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 5e-13 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 2e-10 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 3e-09 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 2e-12 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 4e-07 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 4e-06 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 3e-12 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 1e-09 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 2e-08 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 6e-12 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 2e-08 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 2e-06 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 2e-04 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 1e-10 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 2e-06 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 2e-06 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 5e-04 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 1e-10 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 3e-08 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 4e-07 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 1e-10 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 1e-07 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 8e-07 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 2e-10 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 4e-10 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 5e-07 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 4e-10 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 3e-08 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 1e-07 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 6e-10 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 6e-06 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 9e-05 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 5e-09 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 1e-08 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 2e-08 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 6e-09 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 5e-06 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 4e-05 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 6e-09 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 2e-07 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 2e-05 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 7e-09 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 3e-06 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 4e-06 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 7e-09 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 9e-08 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 1e-06 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 8e-05 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 1e-08 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 2e-05 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 3e-05 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 1e-08 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 2e-06 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 5e-06 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 8e-08 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 2e-05 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 3e-05 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 1e-07 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 4e-05 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 1e-04 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 1e-07 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 2e-05 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 8e-05 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 2e-07 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 6e-05 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 8e-05 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 3e-07 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 8e-05 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 4e-04 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 4e-07 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 5e-07 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 3e-05 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 5e-07 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 1e-06 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 2e-06 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 2e-06 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 4e-04 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 6e-04 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 2e-06 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 4e-04 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 2e-06 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 6e-05 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 2e-04 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 2e-06 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 7e-05 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 8e-04 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 4e-06 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 5e-05 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 4e-06 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 4e-06 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 5e-04 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 7e-06 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 6e-05 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 5e-04 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 7e-05 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 6e-04 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 3e-04 |
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 | Back alignment and structure |
|---|
Score = 128 bits (322), Expect = 8e-36
Identities = 84/191 (43%), Positives = 103/191 (53%), Gaps = 2/191 (1%)
Query: 166 KAAPGKGCPRCGGVVFAAEQVLAKGSEWHRKCFKCRDCNKTLDSINACDGPDKDIYCKTC 225
GK C C V+ AE+V +GS +H+ CF C C K LDS D+ IYCK+C
Sbjct: 3 NWGGGKKCGVCQKAVYFAEEVQCEGSSFHKSCFLCMVCKKNLDSTTVAVHGDE-IYCKSC 61
Query: 226 YGKKHKYCKACYGKNFGPKGFGYGHSPTLVSTSGESTMQFYDARPTSGLKGRNGDGCPRC 285
YGKK+ G G G S + G+S K DGCPRC
Sbjct: 62 YGKKYGPKGKGKGMGAGTLSTDKGESLGIKYEEGQSHRPTNPNASRMAQKVGGSDGCPRC 121
Query: 286 GFVVYAAEQMISKNRIWHRRCFSCADCHRSLDSTNLNDGPDNDIYCRGCYGKNFGPKGCG 345
G VYAAE++I + WH+ CF CA C +SL+ST L D D +IYC+GCY KNFGPKG G
Sbjct: 122 GQAVYAAEKVIGAGKSWHKSCFRCAKCGKSLESTTLAD-KDGEIYCKGCYAKNFGPKGFG 180
Query: 346 FGLGAGALTMA 356
FG GAGAL +
Sbjct: 181 FGQGAGALIHS 191
|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 73 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 356 | |||
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 99.98 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 99.92 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 99.91 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 99.91 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 99.91 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 99.91 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 99.91 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 99.89 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 99.89 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 99.88 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 99.88 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 99.86 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 99.82 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 99.75 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 99.74 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 99.72 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 99.72 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 99.71 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 99.71 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 99.7 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 99.69 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 99.69 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 99.68 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 99.65 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 99.64 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 99.64 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 99.62 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 99.62 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 99.62 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 99.62 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 99.61 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 99.61 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 99.61 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 99.61 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 99.6 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 99.6 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 99.59 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 99.59 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 99.59 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.59 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 99.58 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 99.58 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 99.58 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 99.58 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 99.57 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 99.57 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 99.57 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 99.57 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 99.57 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 99.57 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.56 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 99.56 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 99.56 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 99.55 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 99.55 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 99.55 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.54 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 99.53 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 99.53 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 99.53 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 99.53 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.53 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 99.53 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 99.52 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 99.51 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 99.51 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 99.5 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 99.5 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 99.5 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 99.49 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 99.49 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 99.48 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 99.48 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 99.47 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 99.46 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 99.45 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 99.43 | |
| 2iyb_E | 65 | Testin, TESS, TES; LIM domain, SH3-binding, tumour | 99.43 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 99.42 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 99.42 | |
| 2iyb_E | 65 | Testin, TESS, TES; LIM domain, SH3-binding, tumour | 99.36 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 99.35 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 99.33 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 99.32 | |
| 1zfo_A | 31 | LAsp-1; LIM domain, zinc-finger, metal-binding pro | 98.08 | |
| 1zfo_A | 31 | LAsp-1; LIM domain, zinc-finger, metal-binding pro | 97.96 |
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A | Back alignment and structure |
|---|
Probab=99.98 E-value=1.1e-32 Score=242.62 Aligned_cols=188 Identities=47% Similarity=0.906 Sum_probs=144.6
Q ss_pred CCCCCCCCCCCCccccceEEEeCCceeccCCcccccccccccCCCccccCCcccCccccccccCCCCCccCCCcceeecc
Q psy12252 18 PAENPKCPACGKSVYAAEERVAGGYKFHKMCFKCSMCSKFLDSTNCTEHEKELYCRQCHGRKYGPKGYGFGGGAGCLSMD 97 (356)
Q Consensus 18 ~~~~~~C~~C~~~I~~~~~i~~~~~~~H~~CF~C~~C~~~L~~~~~~~~~g~~yC~~cy~~~~~~~c~~c~~~~~~~~~~ 97 (356)
-...++|..|+++|..++.+.++|+.||++||+|..|+++|.+..|++++|++||+.||.++|+++|.+|+++.|+
T Consensus 4 ~~~~~~C~~C~~~I~~~~~v~a~g~~wH~~CF~C~~C~~~L~~~~~~~~~g~~yC~~cy~~~f~~~c~~c~~~~g~---- 79 (192)
T 1b8t_A 4 WGGGKKCGVCQKAVYFAEEVQCEGSSFHKSCFLCMVCKKNLDSTTVAVHGDEIYCKSCYGKKYGPKGKGKGMGAGT---- 79 (192)
T ss_dssp CCCCEECTTTCCEECSSCCEEETTEEECTTTCBCTTTCCBCCSSSEEEETTEEEEHHHHHHHHSCCCCCCCCCCCC----
T ss_pred CCCCCcCccCCCeecceeEEEeCCceecCCCCcCcccCCcCCCCeeEecCCEeeChhhhHhhcCcccccccccccc----
Confidence 3456899999999997788889999999999999999999999999999999999999999999988766542211
Q ss_pred cccccccCCCCcccccCCceecccCcCcccCCCCCCCCCCCCcCCCCcccccccCCCCCccccccccccCCCCCCCCCCC
Q psy12252 98 AGMCSKFLDSTNCTEHEKELYCRQCHGRKYGPKGYGFGGGAGCLSMDAGEHLTENNAPRTTVIDTAKIKAAPGKGCPRCG 177 (356)
Q Consensus 98 ~~~c~~~l~~~~~~~~~~~~~C~~c~~~~~~p~~~~~~~g~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~ 177 (356)
T Consensus 80 -------------------------------------------------------------------------------- 79 (192)
T 1b8t_A 80 -------------------------------------------------------------------------------- 79 (192)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred --------------------------------------------------------------------------------
Confidence
Q ss_pred ceEecceeeccCCCcccccccccccCcCcCCCCccccCCCCceecccccccCCcccccccccccCCCcccCCCCCceeec
Q psy12252 178 GVVFAAEQVLAKGSEWHRKCFKCRDCNKTLDSINACDGPDKDIYCKTCYGKKHKYCKACYGKNFGPKGFGYGHSPTLVST 257 (356)
Q Consensus 178 ~~I~~~~~i~a~~~~~H~~CF~C~~C~~~l~~~~~~~~~~g~~~C~~c~~~~~~~C~~c~~~~~~~~~~~~~~~~~~~~~ 257 (356)
.+.++.|| |.+..+. . ....+ ..+ ....+.
T Consensus 80 ---------~~~~~~~~---~~~~~~~-------~---~~~~p--~~~-----------~~~~~~--------------- 109 (192)
T 1b8t_A 80 ---------LSTDKGES---LGIKYEE-------G---QSHRP--TNP-----------NASRMA--------------- 109 (192)
T ss_dssp ---------CCCCCCCC---CCCCCCC-------C---CCCCC--CCC-----------CCCCCC---------------
T ss_pred ---------EecCCCcc---ccccccc-------c---cccCC--CCc-----------Cccccc---------------
Confidence 12234455 2221110 0 01111 000 000000
Q ss_pred CCCCccccCCCCCCCCCCCCCCCCCCCCCceeecceEEEeCCcccccCcccccccCCCCCCCCCccCCCCcccccccccc
Q psy12252 258 SGESTMQFYDARPTSGLKGRNGDGCPRCGFVVYAAEQMISKNRIWHRRCFSCADCHRSLDSTNLNDGPDNDIYCRGCYGK 337 (356)
Q Consensus 258 ~~~~~~~~~~~~p~~g~~~~~~~~C~~C~~~I~~~e~v~~~g~~~H~~CF~C~~C~~~L~~~~~~~~~~g~~yC~~c~~~ 337 (356)
...++..+|++|+++|.+++.|.++++.||++||+|+.|+++|.++.|+ ..+|++||+.||.+
T Consensus 110 ----------------~~~~~~~~C~~C~~~I~~~~~v~a~~~~~H~~CF~C~~C~~~L~~~~~~-~~~g~~yC~~cy~~ 172 (192)
T 1b8t_A 110 ----------------QKVGGSDGCPRCGQAVYAAEKVIGAGKSWHKSCFRCAKCGKSLESTTLA-DKDGEIYCKGCYAK 172 (192)
T ss_dssp ----------------CCCCCCEECTTTSCEECSSSCEEETTEEECTTTCBCTTTCCBCCSSSEE-EETTEEEEHHHHHH
T ss_pred ----------------cccCCCCcCCCCCCEecCcEEEecCCCccchhcCCccccCCCCCCCccc-ccCCEEeCHHHHHH
Confidence 1112234799999999988889999999999999999999999988877 69999999999999
Q ss_pred ccCCCccccCCCCCccccC
Q psy12252 338 NFGPKGCGFGLGAGALTMA 356 (356)
Q Consensus 338 ~f~~~~~~~~~~~~~~~~~ 356 (356)
+||++|.+++.++|+|.|+
T Consensus 173 ~f~~kc~~C~~~~g~~~~~ 191 (192)
T 1b8t_A 173 NFGPKGFGFGQGAGALIHS 191 (192)
T ss_dssp HTCCCCCCCCCCCCCCCCC
T ss_pred hcCCcCCCCCCcccceeec
Confidence 9999999999999999875
|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 | Back alignment and structure |
|---|
| >1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 356 | ||||
| d1b8ta2 | 65 | g.39.1.3 (A:36-100) Cysteine-rich (intestinal) pro | 1e-18 | |
| d1b8ta2 | 65 | g.39.1.3 (A:36-100) Cysteine-rich (intestinal) pro | 1e-18 | |
| d1b8ta2 | 65 | g.39.1.3 (A:36-100) Cysteine-rich (intestinal) pro | 2e-15 | |
| d1b8ta2 | 65 | g.39.1.3 (A:36-100) Cysteine-rich (intestinal) pro | 1e-10 | |
| d1b8ta4 | 49 | g.39.1.3 (A:144-192) Cysteine-rich (intestinal) pr | 4e-16 | |
| d1b8ta4 | 49 | g.39.1.3 (A:144-192) Cysteine-rich (intestinal) pr | 3e-14 | |
| d1b8ta4 | 49 | g.39.1.3 (A:144-192) Cysteine-rich (intestinal) pr | 4e-14 | |
| d1b8ta4 | 49 | g.39.1.3 (A:144-192) Cysteine-rich (intestinal) pr | 3e-09 | |
| d1imla2 | 48 | g.39.1.3 (A:29-76) Cysteine-rich (intestinal) prot | 7e-11 | |
| d1imla2 | 48 | g.39.1.3 (A:29-76) Cysteine-rich (intestinal) prot | 4e-09 | |
| d1imla2 | 48 | g.39.1.3 (A:29-76) Cysteine-rich (intestinal) prot | 2e-06 | |
| d1imla2 | 48 | g.39.1.3 (A:29-76) Cysteine-rich (intestinal) prot | 1e-05 | |
| d1b8ta3 | 43 | g.39.1.3 (A:101-143) Cysteine-rich (intestinal) pr | 1e-06 | |
| d1b8ta3 | 43 | g.39.1.3 (A:101-143) Cysteine-rich (intestinal) pr | 2e-06 | |
| d1b8ta3 | 43 | g.39.1.3 (A:101-143) Cysteine-rich (intestinal) pr | 3e-06 | |
| d1a7ia2 | 32 | g.39.1.3 (A:36-67) Cysteine-rich (intestinal) prot | 2e-06 | |
| d1a7ia2 | 32 | g.39.1.3 (A:36-67) Cysteine-rich (intestinal) prot | 1e-05 | |
| d2d8ya1 | 35 | g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapien | 2e-05 | |
| d2d8ya1 | 35 | g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapien | 6e-04 | |
| d2d8ya1 | 35 | g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapien | 0.002 | |
| d2cu8a1 | 30 | g.39.1.3 (A:8-37) Cysteine-rich (intestinal) prote | 7e-05 | |
| d2cu8a1 | 30 | g.39.1.3 (A:8-37) Cysteine-rich (intestinal) prote | 4e-04 | |
| d2cu8a1 | 30 | g.39.1.3 (A:8-37) Cysteine-rich (intestinal) prote | 6e-04 | |
| d1ibia1 | 28 | g.39.1.3 (A:117-144) Cysteine-rich (intestinal) pr | 1e-04 | |
| d1ibia1 | 28 | g.39.1.3 (A:117-144) Cysteine-rich (intestinal) pr | 5e-04 | |
| d1ibia1 | 28 | g.39.1.3 (A:117-144) Cysteine-rich (intestinal) pr | 0.001 | |
| d1ibia2 | 31 | g.39.1.3 (A:145-175) Cysteine-rich (intestinal) pr | 6e-04 | |
| d2co8a2 | 36 | g.39.1.3 (A:8-43) Nedd9 interacting protein with c | 0.002 |
| >d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 65 | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: LIM domain domain: Cysteine-rich (intestinal) protein, CRP, CRIP species: Chicken (Gallus gallus) [TaxId: 9031]
Score = 77.2 bits (190), Expect = 1e-18
Identities = 28/49 (57%), Positives = 33/49 (67%)
Query: 51 CSMCSKFLDSTNCTEHEKELYCRQCHGRKYGPKGYGFGGGAGCLSMDAG 99
C +C K LDST H E+YC+ C+G+KYGPKG G G GAG LS D G
Sbjct: 2 CMVCKKNLDSTTVAVHGDEIYCKSCYGKKYGPKGKGKGMGAGTLSTDKG 50
|
| >d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 65 | Back information, alignment and structure |
|---|
| >d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 65 | Back information, alignment and structure |
|---|
| >d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 65 | Back information, alignment and structure |
|---|
| >d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 49 | Back information, alignment and structure |
|---|
| >d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 49 | Back information, alignment and structure |
|---|
| >d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 49 | Back information, alignment and structure |
|---|
| >d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 49 | Back information, alignment and structure |
|---|
| >d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Length = 48 | Back information, alignment and structure |
|---|
| >d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Length = 48 | Back information, alignment and structure |
|---|
| >d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Length = 48 | Back information, alignment and structure |
|---|
| >d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Length = 48 | Back information, alignment and structure |
|---|
| >d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 43 | Back information, alignment and structure |
|---|
| >d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 43 | Back information, alignment and structure |
|---|
| >d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 43 | Back information, alignment and structure |
|---|
| >d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Length = 32 | Back information, alignment and structure |
|---|
| >d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Length = 32 | Back information, alignment and structure |
|---|
| >d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 | Back information, alignment and structure |
|---|
| >d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 | Back information, alignment and structure |
|---|
| >d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 | Back information, alignment and structure |
|---|
| >d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Length = 30 | Back information, alignment and structure |
|---|
| >d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Length = 30 | Back information, alignment and structure |
|---|
| >d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Length = 30 | Back information, alignment and structure |
|---|
| >d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Length = 28 | Back information, alignment and structure |
|---|
| >d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Length = 28 | Back information, alignment and structure |
|---|
| >d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Length = 28 | Back information, alignment and structure |
|---|
| >d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Length = 31 | Back information, alignment and structure |
|---|
| >d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 356 | |||
| d1b8ta4 | 49 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 99.23 | |
| d1b8ta2 | 65 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.98 | |
| d1x3ha1 | 35 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 98.81 | |
| d1g47a2 | 35 | Pinch (particularly interesting new Cys-His) prote | 98.78 | |
| d1x3ha1 | 35 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 98.74 | |
| d1b8ta4 | 49 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.74 | |
| d1imla2 | 48 | Cysteine-rich (intestinal) protein, CRP, CRIP {Rat | 98.69 | |
| d1g47a2 | 35 | Pinch (particularly interesting new Cys-His) prote | 98.62 | |
| d1b8ta2 | 65 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.43 | |
| d2dara2 | 45 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 98.38 | |
| d2dara2 | 45 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 98.3 | |
| d1x63a1 | 37 | Four and a half LIM domains protein 1, FHL-1 {Huma | 98.29 | |
| d2cuqa2 | 35 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 98.26 | |
| d2d8ya2 | 42 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 98.25 | |
| d1b8ta3 | 43 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.24 | |
| d2cu8a1 | 30 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 98.19 | |
| d2d8ya1 | 35 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 98.16 | |
| d2d8xa2 | 26 | Pinch (particularly interesting new Cys-His) prote | 98.15 | |
| d2cu8a1 | 30 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 98.15 | |
| d2d8za2 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 98.15 | |
| d2d8za2 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 98.14 | |
| d2dj7a2 | 36 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 98.13 | |
| d2co8a2 | 36 | Nedd9 interacting protein with calponin homology, | 98.12 | |
| d1zfoa_ | 30 | LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | 98.12 | |
| d2dj7a1 | 31 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 98.1 | |
| d1b8ta3 | 43 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.09 | |
| d1imla2 | 48 | Cysteine-rich (intestinal) protein, CRP, CRIP {Rat | 98.07 | |
| d2dloa1 | 35 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 98.06 | |
| d1ibia2 | 31 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 98.05 | |
| d2dj7a2 | 36 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 98.03 | |
| d2d8ya1 | 35 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 98.03 | |
| d1x63a1 | 37 | Four and a half LIM domains protein 1, FHL-1 {Huma | 98.02 | |
| d2dloa1 | 35 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 98.01 | |
| d2cuqa2 | 35 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 98.01 | |
| d2cuqa1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.99 | |
| d1x3ha2 | 32 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 97.97 | |
| d1zfoa_ | 30 | LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | 97.97 | |
| d2cuqa1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.95 | |
| d2d8ya2 | 42 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 97.93 | |
| d1u5sb1 | 31 | Pinch (particularly interesting new Cys-His) prote | 97.93 | |
| d1u5sb1 | 31 | Pinch (particularly interesting new Cys-His) prote | 97.92 | |
| d1v6ga1 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 97.82 | |
| d1x3ha2 | 32 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 97.82 | |
| d2dara1 | 32 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 97.82 | |
| d2co8a2 | 36 | Nedd9 interacting protein with calponin homology, | 97.81 | |
| d2dj7a1 | 31 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 97.79 | |
| d1ibia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.79 | |
| d1rutx1 | 30 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 97.78 | |
| d1u5sb2 | 35 | Pinch (particularly interesting new Cys-His) prote | 97.77 | |
| d1x4ka1 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 97.77 | |
| d2d8xa2 | 26 | Pinch (particularly interesting new Cys-His) prote | 97.77 | |
| d2d8za1 | 26 | Four and a half LIM domains protein 2, FHL2 {Human | 97.74 | |
| d1u5sb2 | 35 | Pinch (particularly interesting new Cys-His) prote | 97.73 | |
| d1wyha1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.7 | |
| d2d8za1 | 26 | Four and a half LIM domains protein 2, FHL2 {Human | 97.69 | |
| d1rutx3 | 31 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 97.68 | |
| d2cura2 | 26 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.68 | |
| d2cu8a2 | 33 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 97.67 | |
| d2dloa2 | 33 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 97.66 | |
| d1j2oa1 | 30 | Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 | 97.65 | |
| d1ibia2 | 31 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.64 | |
| d2cu8a2 | 33 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 97.63 | |
| d2cura2 | 26 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.62 | |
| d1rutx1 | 30 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 97.51 | |
| d1v6ga1 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 97.5 | |
| d1j2oa1 | 30 | Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 | 97.48 | |
| d1x4la1 | 29 | Four and a half LIM domains protein 2, FHL2 {Human | 97.48 | |
| d2dara1 | 32 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 97.43 | |
| d2cura1 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.41 | |
| d1x68a1 | 29 | Four and a half LIM domains protein 5, FHL-5 {Huma | 97.41 | |
| d1x4ka2 | 27 | Four and a half LIM domains protein 2, FHL2 {Human | 97.4 | |
| d1b8ta1 | 35 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 97.38 | |
| d1ibia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.38 | |
| d1wyha2 | 27 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.31 | |
| d1wyha2 | 27 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.24 | |
| d1x63a2 | 32 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.21 | |
| d1x4la1 | 29 | Four and a half LIM domains protein 2, FHL2 {Human | 97.21 | |
| d1x4ka1 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 97.19 | |
| d1a7ia2 | 32 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.17 | |
| d1wyha1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.16 | |
| d1x4ka2 | 27 | Four and a half LIM domains protein 2, FHL2 {Human | 97.15 | |
| d1b8ta1 | 35 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 97.15 | |
| d2cupa3 | 27 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.14 | |
| d1rutx3 | 31 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 97.11 | |
| d1a7ia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.06 | |
| d1a7ia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.03 | |
| d1a7ia2 | 32 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.02 | |
| d1x68a1 | 29 | Four and a half LIM domains protein 5, FHL-5 {Huma | 96.94 | |
| d1x61a1 | 27 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 96.74 | |
| d2cura1 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 96.73 | |
| d1x62a2 | 35 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 96.72 | |
| d1x61a2 | 32 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 96.7 | |
| d1x64a1 | 45 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 96.62 | |
| d1x62a2 | 35 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 96.61 | |
| d2dloa2 | 33 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 96.6 | |
| d1x6aa1 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 96.59 | |
| d1x64a1 | 45 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 96.56 | |
| d2cupa3 | 27 | Four and a half LIM domains protein 1, FHL-1 {Huma | 96.27 | |
| d1wiga2 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 96.25 | |
| d1x61a2 | 32 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 95.97 | |
| d1x63a2 | 32 | Four and a half LIM domains protein 1, FHL-1 {Huma | 95.91 | |
| d1x64a2 | 31 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 95.74 | |
| d1wiga1 | 32 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 95.63 | |
| d1wiga1 | 32 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 95.48 | |
| d1g47a1 | 35 | Pinch (particularly interesting new Cys-His) prote | 95.47 | |
| d1x64a2 | 31 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 95.23 | |
| d1x62a1 | 31 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 94.8 | |
| d2cupa2 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 94.52 | |
| d2cora1 | 31 | Pinch (particularly interesting new Cys-His) prote | 94.18 | |
| d1x61a1 | 27 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 93.82 | |
| d1x6aa1 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 93.66 | |
| d1x62a1 | 31 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 93.59 | |
| d1g47a1 | 35 | Pinch (particularly interesting new Cys-His) prote | 92.89 | |
| d1rutx2 | 34 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 92.55 | |
| d1wiga2 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 92.26 | |
| d2cora1 | 31 | Pinch (particularly interesting new Cys-His) prote | 92.09 | |
| d2d8xa1 | 32 | Pinch (particularly interesting new Cys-His) prote | 91.97 | |
| d1rutx4 | 33 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 91.63 | |
| d2cora2 | 35 | Pinch (particularly interesting new Cys-His) prote | 91.58 | |
| d1x6aa2 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 91.43 | |
| d1rutx4 | 33 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 90.61 | |
| d2cupa2 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 87.82 | |
| d1x68a2 | 34 | Four and a half LIM domains protein 5, FHL-5 {Huma | 87.24 | |
| d2cora2 | 35 | Pinch (particularly interesting new Cys-His) prote | 87.08 | |
| d1x6aa2 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 86.71 | |
| d2d8xa1 | 32 | Pinch (particularly interesting new Cys-His) prote | 80.64 |
| >d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: LIM domain domain: Cysteine-rich (intestinal) protein, CRP, CRIP species: Chicken (Gallus gallus) [TaxId: 9031]
Probab=99.23 E-value=8.6e-13 Score=85.10 Aligned_cols=48 Identities=63% Similarity=1.259 Sum_probs=45.2
Q ss_pred cccccCCCCCCCCCccCCCCccccccccccccCCCccccCCCCCccccC
Q psy12252 308 SCADCHRSLDSTNLNDGPDNDIYCRGCYGKNFGPKGCGFGLGAGALTMA 356 (356)
Q Consensus 308 ~C~~C~~~L~~~~~~~~~~g~~yC~~c~~~~f~~~~~~~~~~~~~~~~~ 356 (356)
+|..|++.|++.... ++|++|||+.||.++||||+++++++||+|.++
T Consensus 1 KC~~C~k~Lds~t~~-ehdg~~YCk~CY~k~fGPKG~g~G~gaG~l~~~ 48 (49)
T d1b8ta4 1 RCAKCGKSLESTTLA-DKDGEIYCKGCYAKNFGPKGFGFGQGAGALIHS 48 (49)
T ss_dssp BCTTTCCBCCSSSEE-EETTEEEEHHHHHHHTCCCCCCCCCCCCCCCCC
T ss_pred ChhhcCCccCCCccc-ccCCcccchhhhhhccCCCccCcccCccccccc
Confidence 699999999999877 599999999999999999999999999999875
|
| >d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|