Diaphorina citri psyllid: psy12266


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MVPKLFSTGVLQFCKLVARGELFTPKSHFSLACSMAKSKFEYVREFESHDRCLPNCFIVVRVDGKGFHKFTEAHGFDKPNDRSGLWLMSKAAACVIEEFNEYKMVHK
cccccccccHHHHHHHHHcccccccccccHHHHHHHccccHHHHHcccccccccccEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEc
***KLFSTGVLQFCKLVARGELFTPKSHFSLACSMAKSKFEYVREFESHDRCLPNCFIVVRVDGKGFHKFTEAHGFDKPNDRSGLWLMSKAAACVIEEFNEYKMVHK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVPKLFSTGVLQFCKLVARGELFTPKSHFSLACSMAKSKFEYVREFESHDRCLPNCFIVVRVDGKGFHKFTEAHGFDKPNDRSGLWLMSKAAACVIEEFNEYKMVHK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
tRNA(His) guanylyltransferase Adds a GMP to the 5'-end of tRNA(His) after transcription and RNase P cleavage.confidentQ75DJ3
tRNA(His) guanylyltransferase Adds a GMP to the 5'-end of tRNA(His) after transcription and RNase P cleavage.confidentQ9Y7T3
Probable tRNA(His) guanylyltransferase Adds a GMP to the 5'-end of tRNA(His) after transcription and RNase P cleavage. This step is essential for proper recognition of the tRNA and for the fidelity of protein synthesis.confidentQ9CY52

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OTD, chain A
Confidence level:very confident
Coverage over the Query: 37-106
View the alignment between query and template
View the model in PyMOL