Diaphorina citri psyllid: psy12271

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-----
MSSHFAFSYGVFVGIGAGLSFPPGIFIVTSYFLKYRGLANGIAISGSALGSIFLPPFLRYLLESYGYRRDTEKVREKGEEEEEEEEEEKEEEEEK
ccHHHHHHHHHHHHHHcccccccHHHHcHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccHHHHHHHHcccccHHHHHHHHHHHHHc
MSSHFAFSYGVFVGIGAGLSFPPGIFIVTSYFLKYRGLANGIAISGSALGSIFLPPFLRYLLESYGYRRDTE*VREK******************
xxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSHFAFSYGVFVGIGAGLSFPPGIFIVTSYFLKYRGLANGIAISGSALGSIFLPPFLRYLLESYGYxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008028 [MF]monocarboxylic acid transmembrane transporter activityprobableGO:0022891, GO:0022892, GO:0005342, GO:0008514, GO:0005215, GO:0008509, GO:0015075, GO:0022857, GO:0003674, GO:0046943
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4APS, chain A
Confidence level:confident
Coverage over the Query: 2-72
View the alignment between query and template
View the model in PyMOL