Diaphorina citri psyllid: psy12278


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300
MLVKDMNKGVDSNPNHTVGIVGSKKHGPGNGLNNISPSSSSNSSNSAGTSTDLASLFECPVCFDYVLPPIIQCQSGHLVCSNCRPKLSCCPTCRGPLGNIRNLAMEKVAGTMWFPCRYQMNGCGISLLHTEKPEHEDTCEHRPYLCPCPGASCKWGGALDQVMAHLNQSHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKFDGHQHFFAIVQLIGSRKQSENFTYRLELNGHRRRLTWEATPRSIHEGVASAIMNSDCLVFDTNIAQLFADNGNLGINVTIGTV
ccCCccccccccccccccccccccccccccccccccccccccccccccccccccccCCcccccccccccEEEcccccEEcccccccccccccccccccccccHHHHHHHccCEECcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccEEEEEEccccccccccEEEcccccEEEEEEEEHHcccccccEEEEEEEEEcccccccccEEEEEEEEcccEEEEEECccCEEcccccccccccEEEEEHHHHHHccccccCEEEEEEEEc
****************************************************LASLFECPVCFDYVLPPIIQCQSGHLVCSNCRPKLSCCPTCRGPLGNIRNLAMEKVAGTMWFPCRYQMNGCGISLLHTEKPEHEDTCEHRPYLCPCPGASCKWGGALDQVMAHLNQSHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKFDGHQHFFAIVQLIGSRKQSENFTYRLELNGHRRRLTWEATPRSIHEGVASAIMNSDCLVFDTNIAQLFADNGNLGINVTIGTV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLVKDMNKGVDSNPNHTVGIVGSKKHGPGNGLNNISPSSSSNSSNSAGTSTDLASLFECPVCFDYVLPPIIQCQSGHLVCSNCRPKLSCCPTCRGPLGNIRNLAMEKVAGTMWFPCRYQMNGCGISLLHTEKPEHEDTCEHRPYLCPCPGASCKWGGALDQVMAHLNQSHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKFDGHQHFFAIVQLIGSRKQSENFTYRLELNGHRRRLTWEATPRSIHEGVASAIMNSDCLVFDTNIAQLFADNGNLGINVTIGTV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
E3 ubiquitin-protein ligase Siah1 E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. It probably triggers the ubiquitin-mediated degradation of different substrates.very confidentQ7ZVG6
E3 ubiquitin-protein ligase SIAH1 E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates E3 ubiquitin ligase activity either through direct binding to substrates or by functioning as the essential RING domain subunit of larger E3 complexes. Triggers the ubiquitin-mediated degradation of many substrates, including proteins involved in transcription regulation (MYB, POU2AF1, PML and RBBP8), a cell surface receptor (DCC), cytoplasmic signal transduction molecules (KLF10/TIEG1 and NUMB), an antiapoptotic protein (BAG1), a microtubule motor protein (KIF22), a protein involved in synaptic vesicle function in neurons (SYP), a structural protein (CTNNB1) and SNCAIP. Confers constitutive instability to HIPK2 through proteasomal degradation. It is thereby involved in many cellular processes such as apoptosis, tumor suppression, cell cycle, axon guidance, transcription, spermatogenesis and TNF-alpha signaling. Has some overlapping function with SIAH2. Induces apoptosis in cooperation with PEG3 (By similarity). Upon nitric oxid (NO) generation that follows apoptotic stimulation, interacts with S-nitrosylated GAPDH, mediating the translocation of GAPDH to the nucleus. GAPDH acts as a stabilizer of SIAH1, facilitating the degradation of nuclear proteins.very confidentQ920M9
E3 ubiquitin-protein ligase SIAH1B E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates E3 ubiquitin ligase activity either through direct binding to substrates or by functioning as the essential RING domain subunit of larger E3 complexes. Confers constitutive instability to HIPK2 through proteasomal degradation. Probably triggers the ubiquitin-mediated degradation of many substrates. Upon nitric oxid (NO) generation that follows apoptotic stimulation, interacts with S-nitrosylated GAPDH, mediating the translocation of GAPDH to the nucleus. GAPDH acts as a stabilizer of SIAH1, facilitating the degradation of nuclear proteins.very confidentQ06985

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030163 [BP]protein catabolic processvery confidentGO:0044238, GO:1901575, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152, GO:0009056, GO:0009057
GO:0005737 [CC]cytoplasmvery confidentGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005829 [CC]cytosolconfidentGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0000151 [CC]ubiquitin ligase complexconfidentGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0030877 [CC]beta-catenin destruction complexconfidentGO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0043161 [BP]proteasomal ubiquitin-dependent protein catabolic processconfidentGO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0005634 [CC]nucleusconfidentGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0043065 [BP]positive regulation of apoptotic processconfidentGO:0050794, GO:0050789, GO:0048518, GO:0043067, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0005886 [CC]plasma membraneconfidentGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005769 [CC]early endosomeconfidentGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0008270 [MF]zinc ion bindingconfidentGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0007283 [BP]spermatogenesisconfidentGO:0044702, GO:0048609, GO:0032504, GO:0019953, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0048232, GO:0007276, GO:0000003
GO:0016567 [BP]protein ubiquitinationconfidentGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0032446, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0043025 [CC]neuronal cell bodyconfidentGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0004842 [MF]ubiquitin-protein ligase activityconfidentGO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0031648 [BP]protein destabilizationconfidentGO:0019222, GO:0060255, GO:0010608, GO:0031647, GO:0050789, GO:0065007, GO:0008150, GO:0065008, GO:0010468
GO:0008022 [MF]protein C-terminus bindingconfidentGO:0003674, GO:0005488, GO:0005515
GO:0009791 [BP]post-embryonic developmentconfidentGO:0032502, GO:0032501, GO:0044707, GO:0008150, GO:0007275, GO:0044699
GO:0007411 [BP]axon guidanceconfidentGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0043621 [MF]protein self-associationconfidentGO:0003674, GO:0005488, GO:0005515
GO:0043005 [CC]neuron projectionconfidentGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0031396 [BP]regulation of protein ubiquitinationconfidentGO:0032268, GO:0080090, GO:0019222, GO:0060255, GO:0051246, GO:0031323, GO:0050794, GO:0065007, GO:0031399, GO:0008150, GO:0050789
GO:2001244 [BP]positive regulation of intrinsic apoptotic signaling pathwayconfidentGO:2001235, GO:0010646, GO:2001233, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0010941, GO:0050794, GO:0023056, GO:0043067, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0048522, GO:0042981, GO:0050789, GO:2001242
GO:0042803 [MF]protein homodimerization activityconfidentGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0031624 [MF]ubiquitin conjugating enzyme bindingconfidentGO:0005488, GO:0003674, GO:0019899, GO:0044390, GO:0005515
GO:0007141 [BP]male meiosis IconfidentGO:0007126, GO:0007127, GO:0051321, GO:0000003, GO:0044699, GO:0009987, GO:0008150, GO:0048610, GO:0022402, GO:0007049, GO:0044763, GO:0007140
GO:0051402 [BP]neuron apoptotic processconfidentGO:0010259, GO:0009987, GO:0070997, GO:0006915, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0097285, GO:0044699
GO:0040014 [BP]regulation of multicellular organism growthconfidentGO:0008150, GO:0040008, GO:0065007, GO:0050789, GO:0051239
GO:0007465 [BP]R7 cell fate commitmentconfidentGO:0046552, GO:0048749, GO:0044707, GO:0030154, GO:0045466, GO:0009653, GO:0042706, GO:0044699, GO:0001745, GO:0048869, GO:0007275, GO:0048513, GO:0032502, GO:0009887, GO:0032501, GO:0048663, GO:0030182, GO:0048592, GO:0009987, GO:0044767, GO:0001654, GO:0048731, GO:0001754, GO:0022008, GO:0001751, GO:0001752, GO:0048699, GO:0045165, GO:0007399, GO:0007423, GO:0048856, GO:0044763, GO:0046530, GO:0008150
GO:0045676 [BP]regulation of R7 cell differentiationconfidentGO:0022603, GO:0030154, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0007275, GO:0045664, GO:0065007, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0044763, GO:0046532, GO:0051960, GO:2000026, GO:2000027, GO:0048731
GO:2001237 [BP]negative regulation of extrinsic apoptotic signaling pathwayprobableGO:2001234, GO:2001236, GO:0010941, GO:0009968, GO:2001233, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0043067, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0042981, GO:0050789, GO:0048523
GO:0090090 [BP]negative regulation of canonical Wnt receptor signaling pathwayprobableGO:0009968, GO:0008150, GO:0009966, GO:0048585, GO:0048583, GO:0048519, GO:0050794, GO:0050789, GO:0023057, GO:0030111, GO:0065007, GO:0010648, GO:0023051, GO:0048523, GO:0010646, GO:0030178, GO:0060828
GO:0043154 [BP]negative regulation of cysteine-type endopeptidase activity involved in apoptotic processprobableGO:0019222, GO:0007569, GO:0010941, GO:0042981, GO:0050789, GO:0044699, GO:0051346, GO:2000116, GO:2000117, GO:0043086, GO:0043067, GO:0010466, GO:0065007, GO:0044092, GO:0043281, GO:0065009, GO:0010259, GO:0006915, GO:0052547, GO:0052548, GO:0009987, GO:0050794, GO:0012501, GO:0044763, GO:0010951, GO:0051336, GO:0050790, GO:0008150
GO:0003714 [MF]transcription corepressor activityprobableGO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042787 [BP]protein ubiquitination involved in ubiquitin-dependent protein catabolic processprobableGO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0070647, GO:0032446, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0044237, GO:0043170, GO:0016567, GO:0006511
GO:0043066 [BP]negative regulation of apoptotic processprobableGO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0007264 [BP]small GTPase mediated signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0007093 [BP]mitotic cell cycle checkpointprobableGO:0007346, GO:0000075, GO:0051726, GO:0010564, GO:0050794, GO:0008150, GO:1901987, GO:0010948, GO:0065007, GO:1901991, GO:1901990, GO:0048519, GO:0048523, GO:0050789, GO:1901988

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2A25, chain A
Confidence level:very confident
Coverage over the Query: 143-300
View the alignment between query and template
View the model in PyMOL
Template: 3HCS, chain A
Confidence level:confident
Coverage over the Query: 49-183
View the alignment between query and template
View the model in PyMOL