Diaphorina citri psyllid: psy12283

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------79

MTPLPSPSEEQDRLLEEASHIVKTQSLQMKRCLDSDKLMDALKHASTMLSELRTSLLSPKNYYELYMAVTDELRQLELYLVDEFQRGRKVPDLYELVQYAGNIVPRLYLLITVALVYIKTNSSLKRDLLKDLVEMCRGVQHPLRGLFLRNYLLQCTRNVLPDTPEDEGDQAEGTVRDSVDFILMNFAEMNKLWVRMQHQGHSRDKERREREREELRILVGTNLVRLSELDSITRDKYKKLVLPGILEQVVSCRDAIAQEYLMECIIQVFPDEFHLATLTAFLKSCAELQAGVNVKNILIALIDRLSLYAQKNKEFNSLFETFSEQVASIVQSRIDMPAEDIVALQVSLINLALKCYPDKVDYIDKILQTTVETFQKLNIERVEYNTPVSRELMRLLKIFIDQYNNILTVIQLTYFAPLMELFDFYGRKSVSAYLITNALNNDTLVPTSESVDSILTIVSSLVQDQDDQPAEEEDPEDFAEEQGLLGRLVHQFKSDVPDQQYLILSTARKHFQAGGKKRIKHTLPPLVFQAYQLATQFSALREEDEMWSKKCSKIFRFCHQIILSLIKAELAELPLRLFLQGAMTIGSIDFENHETISYEFISQALSLYEEEISESKCQLAAITLLVGTFEKMSCFGEENAEPIRTQSALAASKLFKKPDQCSGVCTCSHLFWSGKNSQGEEIRDGKRVLECLKKGVRIASQCMDMSVQVQLFIELLNHYIYYFEKKNEHITVAMLNQLIGKIRDELANLESNEETEQISKHFTNTLFHLRNRQEGPPVDGISYEGLTL

cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccccccccccHHHcHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcHHHHHHHHHHcHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccccccccccccc

******P****DRLLEEASHIVKTQSLQMKRCLDSDKLMDALKHASTMLSELRTSLLSPKNYYELYMAVTDELRQLELYLVDEFQRGRKVPDLYELVQYAGNIVPRLYLLITVALVYIKTNSSLKRDLLKDLVEMCRGVQHPLRGLFLRNYLLQCTRNVLPDTPEDEG**AEGTVRDSVDFILMNFAEMNKLWVRMQ****************ELRILVGTNLVRLSELDSITRDKYKKLVLPGILEQVVSCRDAIAQEYLMECIIQVFPDEFHLATLTAFLKSCAELQAGVNVKNILIALIDRLSLYAQKNKEFNSLFETFSEQVASIVQSRIDMPAEDIVALQVSLINLALKCYPDKVDYIDKILQTTVETFQKLNIERVEYNTPVSRELMRLLKIFIDQYNNILTVIQLTYFAPLMELFDFYGRKSVSAYLITNALNNDTLVPTSESVDSILTIVSSLVQD*D**********DFAEEQGLLGRLVHQFKSDVPDQQYLILSTARKHFQAGGKKRIKHTLPPLVFQAYQLATQFSALREEDEMWSKKCSKIFRFCHQIILSLIKAELAELPLRLFLQGAMTIGSIDFENHETISYEFISQALSLYEEEISESKCQLAAITLLVGTFEKMSCFGEENAEPIRTQSALAASKLFKKPDQCSGVCTCSHLFWSGKNSQGEEIRDGKRVLECLKKGVRIASQCMDMSVQVQLFIELLNHYIYYFEKKNEHITVAMLNQLIGKIRDELA************KHFTNTLFH*************SYEGLTL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MTPLPSPSEEQDRLLEEASHIVKTQSLQMKRCLDSDKLMDALKHASTMLSELRTSLLSPKNYYELYMAVTDELRQLELYLVDEFQRGRKVPDLYELVQYAGNIVPRLYLLITVALVYIKTNSSLKRDLLKDLVEMCRGVQHPLRGLFLRNYLLQCTRNVLPDTPEDEGDQAEGTVRDSVDFILMNFAEMNKLWVRMQHQGHSRDKERREREREELRILVGTNLVRLSELDSITRDKYKKLVLPGILEQVVSCRDAIAQEYLMECIIQVFPDEFHLATLTAFLKSCAELQAGVNVKNILIALIDRLSLYAQKNKEFNSLFETFSEQVASIVQSRIDMPAEDIVALQVSLINLALKCYPDKVDYIDKILQTTVETFQKLNIERVEYNTPVSRELMRLLKIFIDQYNNILTVIQLTYFAPLMELFDFYGRKSVSAYLITNALNNDTLVPTSESVDSILTIVSSLVQDQDDQPAEEEDPEDFAEEQGLLGRLVHQFKSDVPDQQYLILSTARKHFQAGGKKRIKHTLPPLVFQAYQLATQFSALREEDEMWSKKCSKIFRFCHQIILSLIKAELAELPLRLFLQGAMTIGSIDFENHETISYEFISQALSLYEEEISESKCQLAAITLLVGTFEKMSCFGEENAEPIRTQSALAASKLFKKPDQCSGVCTCSHLFWSGKNSQGEEIRDGKRVLECLKKGVRIASQCMDMSVQVQLFIELLNHYIYYFEKKNEHITxxxxxxxxxxxxxxxxxxxxxEETEQISKHFTNTLFHLRNRQEGPPVDGISYEGLTL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Vacuolar protein sorting-associated protein 35	Essential component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network. Also required to regulate transcytosis of the polymeric immunoglobulin receptor (pIgR-pIgA).	very confident	Q2HJG5
Vacuolar protein sorting-associated protein 35	Essential component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network. Also required to regulate transcytosis of the polymeric immunoglobulin receptor (pIgR-pIgA).	very confident	Q96QK1
Vacuolar protein sorting-associated protein 35	Essential component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network. Also required to regulate transcytosis of the polymeric immunoglobulin receptor (pIgR-pIgA).	very confident	Q9EQH3

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005829 [CC]	cytosol	confident	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005768 [CC]	endosome	confident	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005771 [CC]	multivesicular body	probable	GO:0005737, GO:0043231, GO:0043227, GO:0005770, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0015031 [BP]	protein transport	probable	GO:0033036, GO:0008104, GO:0006810, GO:0045184, GO:0008150, GO:0071702, GO:0051234, GO:0051179
GO:0016021 [CC]	integral to membrane	probable	GO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0034613 [BP]	cellular protein localization	probable	GO:0008104, GO:0070727, GO:0009987, GO:0044763, GO:0008150, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0006624 [BP]	vacuolar protein processing	probable	GO:0044267, GO:0044260, GO:0051604, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0010467, GO:0008150, GO:0008152, GO:0016485
GO:0006897 [BP]	endocytosis	probable	GO:0006810, GO:0008150, GO:0016192, GO:0051234, GO:0051179
GO:0042147 [BP]	retrograde transport, endosome to Golgi	probable	GO:0016197, GO:0009987, GO:0016192, GO:0046907, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0008219 [BP]	cell death	probable	GO:0010259, GO:0008150, GO:0009987, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R17, chain C
Confidence level:very confident
Coverage over the Query: 477-772
View the alignment between query and template
View the model in PyMOL